E3 ubiquitin-protein ligase RNF125 (Rnf125) Recombinant Protein | Rnf125 recombinant protein
Recombinant Mouse E3 ubiquitin-protein ligase RNF125 (Rnf125)
Gene Names
Rnf125; 4930553F04Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
E3 ubiquitin-protein ligase RNF125 (Rnf125); Recombinant Mouse E3 ubiquitin-protein ligase RNF125 (Rnf125); Rnf125 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-233, full length protein
Sequence
GSLLSSDSSKSAPASATPRTLERSGDSELPITSFDCSVCLEVLHQPVRTRCGHVFCRSCIATSIKNNNKWTCPYCRAYLPSEGVPATDIAKRMKSEYQNCAECGTLVCLSDMRAHIRTCEKYIDKYGPLLELGDTTARCVCPFCQRELDEDCLLDHCIIHHRSERRPVFCPLCHSRPDESPSTFNGSLIRHLQVSHTLFYDDFIDFDIIEEAIIRRVLDRSLLEYVNQSNTT
Sequence Length
232
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Rnf125 recombinant protein
This gene encodes a novel E3 ubiquitin ligase that contains an N-terminal RING finger domain. The encoded protein may function as a positive regulator in the T-cell receptor signaling pathway.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
16,302 Da
NCBI Official Full Name
E3 ubiquitin-protein ligase RNF125
NCBI Official Synonym Full Names
ring finger protein 125
NCBI Official Symbol
Rnf125
NCBI Official Synonym Symbols
4930553F04Rik
NCBI Protein Information
E3 ubiquitin-protein ligase RNF125
UniProt Protein Name
E3 ubiquitin-protein ligase RNF125
Protein Family
UniProt Gene Name
Rnf125
Uniprot Description
E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins, such as DDX58/RIG-I, MAVS/IPS1, IFIH1/MDA5, JAK1 and p53/TP53. Acts as a negative regulator of type I interferon production by mediating ubiquitination of DDX58/RIG-I at 'Lys-181', leading to DDX58/RIG-I degradation. Mediates ubiquitination and subsequent degradation of p53/TP53. Mediates ubiquitination and subsequent degradation of JAK1. Acts as a positive regulator of T-cell activation.
Research Articles on Rnf125
Similar Products
Product Notes
The Rnf125 rnf125 (Catalog #AAA1426512) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-233, full length protein. The amino acid sequence is listed below: GSLLSSDSSK SAPASATPRT LERSGDSELP ITSFDCSVCL EVLHQPVRTR CGHVFCRSCI ATSIKNNNKW TCPYCRAYLP SEGVPATDIA KRMKSEYQNC AECGTLVCLS DMRAHIRTCE KYIDKYGPLL ELGDTTARCV CPFCQRELDE DCLLDHCIIH HRSERRPVFC PLCHSRPDES PSTFNGSLIR HLQVSHTLFY DDFIDFDIIE EAIIRRVLDR SLLEYVNQSN TT. It is sometimes possible for the material contained within the vial of "E3 ubiquitin-protein ligase RNF125 (Rnf125), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
