Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

E3 ubiquitin-protein ligase RNF103 (Rnf103) Recombinant Protein | Rnf103 recombinant protein

Recombinant Mouse E3 ubiquitin-protein ligase RNF103 (Rnf103)

Gene Names
Rnf103; kf-1; Zfp103; AW146237; AW212918
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
E3 ubiquitin-protein ligase RNF103 (Rnf103); Recombinant Mouse E3 ubiquitin-protein ligase RNF103 (Rnf103); Rnf103 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-683aa; full length protein
Sequence
MWLKLFFLLLYFLVLFVLARFFEAIVWYETGIFATQLVDPVALSFKKLKTILECRGLGYS GLPEKKDVRELVEKSGDLMEGELYSALKEEEASESVSSTNFSGEMHFYELVEDTKDGIWL VQVIANDRSPLVGKIHWEKMVKKVSRFGIRTGTFNCSSDPRYCRRRGWVRSTLIMSVPQT STSKGKVMLKEYSGRKIEVEHIFKWITAHAASRIKTIYNVEHLKEEWNKSDQYWVKIYLF ANLDQPPAFFSALSIKFTGRVEFIFVNVENWNNKSYMTDIGIYNMPSYILRTPEGIYRYG NHTGEFISLQAMDSFLRSLQPEVNDLFVLSLVLVNLMAWMDLFITQGATIKRFVVLISTL GTYNSLLIISWLPVLGFLQLPYLDSFYDYSLRLLRYSNTTTLASWVRADWMFYTSHPALF LSTYLGHGLLIDYFEKKRRRSNNDEVNANNLEWLSSLWDWYTSYLFHPIASFQNFPVDSD WDEDPDLFLERLAFPDLWLHPLIPTDYIKNLPMWRFKCLGVQSEEEMSESSQDTENDSDS DNMDTFSSSKDIFEDKQSVVHSSPGRTSHCDTEACSCANKCESSPCERKRRSYGSHNTDE DMEPDWLTWPAGTLHCTECVVCLENFENGCLLMGLPCGHVFHQNCIVMWLAGGRHCCPVC RWPSYKKKQPYAQQQPLSNDVPS
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Rnf103 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
79,189 Da
NCBI Official Full Name
E3 ubiquitin-protein ligase RNF103 isoform 1
NCBI Official Synonym Full Names
ring finger protein 103
NCBI Official Symbol
Rnf103
NCBI Official Synonym Symbols
kf-1; Zfp103; AW146237; AW212918
NCBI Protein Information
E3 ubiquitin-protein ligase RNF103
UniProt Protein Name
E3 ubiquitin-protein ligase RNF103
UniProt Gene Name
Rnf103
UniProt Synonym Gene Names
Zfp103; mKF-1; Zfp-103
UniProt Entry Name
RN103_MOUSE

NCBI Description

This gene encodes a member of the RING finger family of E3 ubiquitin-protein ligases. These proteins catalyze the transfer of the ubiquitin protein from a ubiquitin E2 enzyme to a protein substrate. Homozygous knockout mice for this gene exhibit enhanced anxiety-like behavior. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2015]

Uniprot Description

RNF103: Acts as an E2-dependent E3 ubiquitin-protein ligase, probably involved in the ER-associated protein degradation pathway.

Protein type: Ubiquitin ligase; EC 6.3.2.19; Membrane protein, multi-pass; Membrane protein, integral; Ubiquitin conjugating system; EC 6.3.2.-

Cellular Component: endoplasmic reticulum; integral to membrane; membrane

Molecular Function: coenzyme F420-0 gamma-glutamyl ligase activity; coenzyme F420-2 alpha-glutamyl ligase activity; ligase activity; metal ion binding; ribosomal S6-glutamic acid ligase activity; ubiquitin-protein ligase activity; UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate-D-alanyl-D-alanine ligase activity; zinc ion binding

Biological Process: ER-associated protein catabolic process; protein ubiquitination

Research Articles on Rnf103

Similar Products

Product Notes

The Rnf103 rnf103 (Catalog #AAA7028707) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-683aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Rnf103 rnf103 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MWLKLFFLLL YFLVLFVLAR FFEAIVWYET GIFATQLVDP VALSFKKLKT ILECRGLGYS GLPEKKDVRE LVEKSGDLME GELYSALKEE EASESVSSTN FSGEMHFYEL VEDTKDGIWL VQVIANDRSP LVGKIHWEKM VKKVSRFGIR TGTFNCSSDP RYCRRRGWVR STLIMSVPQT STSKGKVMLK EYSGRKIEVE HIFKWITAHA ASRIKTIYNV EHLKEEWNKS DQYWVKIYLF ANLDQPPAFF SALSIKFTGR VEFIFVNVEN WNNKSYMTDI GIYNMPSYIL RTPEGIYRYG NHTGEFISLQ AMDSFLRSLQ PEVNDLFVLS LVLVNLMAWM DLFITQGATI KRFVVLISTL GTYNSLLIIS WLPVLGFLQL PYLDSFYDYS LRLLRYSNTT TLASWVRADW MFYTSHPALF LSTYLGHGLL IDYFEKKRRR SNNDEVNANN LEWLSSLWDW YTSYLFHPIA SFQNFPVDSD WDEDPDLFLE RLAFPDLWLH PLIPTDYIKN LPMWRFKCLG VQSEEEMSES SQDTENDSDS DNMDTFSSSK DIFEDKQSVV HSSPGRTSHC DTEACSCANK CESSPCERKR RSYGSHNTDE DMEPDWLTWP AGTLHCTECV VCLENFENGC LLMGLPCGHV FHQNCIVMWL AGGRHCCPVC RWPSYKKKQP YAQQQPLSND VPS. It is sometimes possible for the material contained within the vial of "E3 ubiquitin-protein ligase RNF103 (Rnf103), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.