DNA-directed RNA polymerase II subunit RPB7 Recombinant Protein | RNA polymerase II recombinant protein

Recombinant Glycine max DNA-directed RNA polymerase II subunit RPB7

Cat. Num. AAA1248548

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: DNA-directed RNA polymerase II subunit RPB7; Recombinant Glycine max DNA-directed RNA polymerase II subunit RPB7; RNA polymerase II recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-176, Full length protein
• Sequence: MFFHIVLERNMQLHPRYFGRNLRDNLVSKLMKDVEGTCSGRHGFVVAVTGIENIGKGLIRDGTGFVTFPVKYQCVVFRPFKGEILEAVVTMVNKMGFFAEAGPVQIFVSNHLIPDDMEFQSGDMPNYTTSDGSVKIQKDSEVRLKIIGTRVDATEIFCIGTIKDDFLGVINDPATV
• Sequence Length: 176

• Species: Glycine max (Soybean) (Glycine hispida)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 351722267
• NCBI GeneID: 547985
• NCBI Accession #: NP_001236982.1
• NCBI GenBank Nucleotide #: NM_001250053.2
• UniProt Accession #: P46279
• Molecular Weight: 19,625 Da
• NCBI Official Full Name: DNA-directed RNA polymerase II subunit RPB7
• NCBI Official Symbol: RNA polymerase II
• NCBI Protein Information: DNA-directed RNA polymerase II subunit RPB7
• UniProt Protein Name: DNA-directed RNA polymerase II subunit RPB7
• Protein Family: DNA-directed RNA polymerase
• UniProt Gene Name: RNA polymerase II subunit B7
• UniProt Synonym Gene Names: RNA polymerase II subunit B7

Uniprot Description

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase II which synthesizes mRNA precursors and many functional non-coding RNAs. Pol II is the central component of the basal RNA polymerase II transcription machinery. It is composed of mobile elements that move relative to each other. RPB7 is part of a subcomplex with RPB4 that binds to a pocket formed by RPB1, RPB2 and RPB6 at the base of the clamp element. The RBP4-RPB7 subcomplex seems to lock the clamp via RPB7 in the closed conformation thus preventing double-stranded DNA to enter the active site cleft. The RPB4-RPB7 subcomplex binds single-stranded DNA and RNA ().