Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

E3 ubiquitin-protein ligase RMA2 (RMA2) Recombinant Protein | RMA2 recombinant protein

Recombinant Arabidopsis thaliana E3 ubiquitin-protein ligase RMA2 (RMA2)

Gene Names
RMA2; ATRMA2; F26K10.150; F26K10_150; RING membrane-anchor 2; RMA2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
E3 ubiquitin-protein ligase RMA2 (RMA2); Recombinant Arabidopsis thaliana E3 ubiquitin-protein ligase RMA2 (RMA2); Recombinant E3 ubiquitin-protein ligase RMA2 (RMA2); E3 ubiquitin-protein ligase RMA2 EC= 6.3.2.-; Protein RING membrane-anchor 2; RMA2 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-193
Sequence
MEIEKDEDDTTLVDSGGDFDCNICLDQVRDPVVTLCGHLFCWPCIHKWTYASNNSRQRVDQYDHKREPPKCPVCKSDVSEATLVPIYGRGQKAPQSGSNVPSRPTGPVYDLRGVGQRLGEGESQRYMYRMPDPVMGVVCEMVYRRLFGESSSNMAPYRDMNVRSRRRAMQAEESLSRVYLFLLCFMFMCLFLF
Sequence Length
193
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22,178 Da
NCBI Official Full Name
E3 ubiquitin-protein ligase RMA2
NCBI Official Symbol
RMA2
NCBI Official Synonym Symbols
ATRMA2; F26K10.150; F26K10_150; RING membrane-anchor 2; RMA2
NCBI Protein Information
E3 ubiquitin-protein ligase RMA2
UniProt Protein Name
E3 ubiquitin-protein ligase RMA2
UniProt Gene Name
RMA2
UniProt Synonym Gene Names
A-RZF
UniProt Entry Name
RMA2_ARATH

NCBI Description

Encodes a RING finger E3 ubiquitin ligase. Binds and ubiquitinates ABP1 in vivo and in vitro.

Uniprot Description

Function: E3 ubiquitin-protein ligase that promotes the ubiquitination and proteasomal degradation of the auxin-binding protein ERABP1. Ref.6 Ref.8

Pathway: Protein modification; protein ubiquitination.

Subunit structure: Interacts with ERABP1. Ref.8

Subcellular location: Endoplasmic reticulum membrane; Single-pass type IV membrane protein Ref.6.

Tissue specificity: Barely detected in roots and limited to the root tips. Expressed in leaf hydathodes and in siliques. Ref.1 Ref.6

Developmental stage: Expressed during seed development. Ref.1

Domain: The RING-type zinc finger domain is required for E3 ligase activity.

Disruption phenotype: No visible phenotype and no effect on drought stress response, probably due to the redundancy with RMA1 and RMA3. Ref.7

Sequence similarities: Contains 1 RING-type zinc finger.

Research Articles on RMA2

Similar Products

Product Notes

The RMA2 rma2 (Catalog #AAA1189248) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-193. The amino acid sequence is listed below: MEIEKDEDDT TLVDSGGDFD CNICLDQVRD PVVTLCGHLF CWPCIHKWTY ASNNSRQRVD QYDHKREPPK CPVCKSDVSE ATLVPIYGRG QKAPQSGSNV PSRPTGPVYD LRGVGQRLGE GESQRYMYRM PDPVMGVVCE MVYRRLFGES SSNMAPYRDM NVRSRRRAMQ AEESLSRVYL FLLCFMFMCL FLF. It is sometimes possible for the material contained within the vial of "E3 ubiquitin-protein ligase RMA2 (RMA2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.