Opsin Rh4 (Rh4) Recombinant Protein | Rh4 recombinant protein
Recombinant Drosophila melanogaster Opsin Rh4 (Rh4)
Gene Names
Rh4; CG9668; Dm Rh4; DMELRH4; DmelCG9668; FBgn0003250; Rh; rh4; RH4
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Opsin Rh4 (Rh4); Recombinant Drosophila melanogaster Opsin Rh4 (Rh4); Recombinant Opsin Rh4 (Rh4); Opsin Rh4; Inner R7 photoreceptor cells opsin; Rh4 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-378
Sequence
MEPLCNASEPPLRPEARSSGNGDLQFLGWNVPPDQIQYIPEHWLTQLEPPASMHYMLGVFYIFLFCASTVGNGMVIWIFSTSKSLRTPSNMFVLNLAVFDLIMCLKAPIFIYNSFHRGFALGNTWCQIFASIGSYSGIGAGMTNAAIGYDRYNVITKPMNRNMTFTKAVIMNIIIWLYCTPWVVLPLTQFWDRFVPEGYLTSCSFDYLSDNFDTRLFVGTIFFFSFVCPTLMILYYYSQIVGHVFSHEKALREQAKKMNVESLRSNVDKSKETAEIRIAKAAITICFLFFVSWTPYGVMSLIGAFGDKSLLTPGATMIPACTCKLVACIDPFVYAISHPRYRLELQKRCPWLGVNEKSGEISSAQSTTTQEQQQTTAA
Sequence Length
378
Species
Drosophila melanogaster (Fruit fly)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
42,658 Da
NCBI Official Full Name
rhodopsin 4
NCBI Official Synonym Full Names
Rhodopsin 4
NCBI Official Symbol
Rh4
NCBI Official Synonym Symbols
CG9668; Dm Rh4; DMELRH4; DmelCG9668; FBgn0003250; Rh; rh4; RH4
NCBI Protein Information
CG9668 gene product from transcript CG9668-RA; CG9668-PA; Rh4-PA; rhodopsin; rhodopsin 4
UniProt Protein Name
Opsin Rh4
Protein Family
UniProt Gene Name
Rh4
UniProt Entry Name
OPS4_DROME
Uniprot Description
Function: Visual pigments are the light-absorbing molecules that mediate vision. They consist of an apoprotein, opsin, covalently linked to cis-retinal.
Subcellular location: Membrane; Multi-pass membrane protein.
Post-translational modification: Phosphorylated on some or all of the serine and threonine residues present in the C-terminal region.
Miscellaneous: Each Drosophila eye is composed of 800 facets or ommatidia. Each ommatidium contains 8 photoreceptor cells (R1-R8), the R1 to R6 cells are outer cells, while R7 and R8 are inner cells.Opsin Rh4 is sensitive to UV light.
Sequence similarities: Belongs to the G-protein coupled receptor 1 family. Opsin subfamily.
Research Articles on Rh4
Similar Products
Product Notes
The Rh4 rh4 (Catalog #AAA1131163) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-378. The amino acid sequence is listed below: MEPLCNASEP PLRPEARSSG NGDLQFLGWN VPPDQIQYIP EHWLTQLEPP ASMHYMLGVF YIFLFCASTV GNGMVIWIFS TSKSLRTPSN MFVLNLAVFD LIMCLKAPIF IYNSFHRGFA LGNTWCQIFA SIGSYSGIGA GMTNAAIGYD RYNVITKPMN RNMTFTKAVI MNIIIWLYCT PWVVLPLTQF WDRFVPEGYL TSCSFDYLSD NFDTRLFVGT IFFFSFVCPT LMILYYYSQI VGHVFSHEKA LREQAKKMNV ESLRSNVDKS KETAEIRIAK AAITICFLFF VSWTPYGVMS LIGAFGDKSL LTPGATMIPA CTCKLVACID PFVYAISHPR YRLELQKRCP WLGVNEKSGE ISSAQSTTTQ EQQQTTAA. It is sometimes possible for the material contained within the vial of "Opsin Rh4 (Rh4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
