Retrograde Golgi transport protein RGP1 homolog (RGP1) Recombinant Protein | RGP1 recombinant protein
Recombinant Human Retrograde Golgi transport protein RGP1 homolog (RGP1)
Gene Names
RGP1; KIAA0258
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Retrograde Golgi transport protein RGP1 homolog (RGP1); Recombinant Human Retrograde Golgi transport protein RGP1 homolog (RGP1); RGP1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-391, Full length protein
Sequence
MIEVVAELSRGPVFLAGEALECVVTVTNPLPPTATSASSEALAWASAQIHCQFHASESRVALPPPDSSQPDVQPDSQTVFLPHRGERGQCILSTPPKILFCDLRLDPGESKSYSYSEVLPIEGPPSFRGQSVKYVYKLTIGCQRVNSPITLLRVPLRVLVLTGLQDVRFPQDEAVAPSSPFLEEDEGGKKDSWLAELAGERLMAATSCRSLHLYNISDGRGKVGTFGIFKSVYRLGEDVVGTLNLGEGTVACLQFSVSLQTEERVQPEYQRRRGAGGVPSVSHVTHARHQESCLHTTRTSFSLPIPLSSTPGFCTAIVSLKWRLHFEFVTSREPGLVLLPPVEQPEPTTWTGPEQVPVDTFSWDLPIKVLPTSPTLASYAAPGPSTSTITI
Sequence Length
391
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
42,455 Da
NCBI Official Full Name
RAB6A-GEF complex partner protein 2
NCBI Official Synonym Full Names
RGP1 homolog, RAB6A GEF complex partner 1
NCBI Official Symbol
RGP1
NCBI Official Synonym Symbols
KIAA0258
NCBI Protein Information
RAB6A-GEF complex partner protein 2
UniProt Protein Name
RAB6A-GEF complex partner protein 2
Protein Family
UniProt Gene Name
RGP1
Uniprot Description
The RIC1-RGP1 complex acts as a guanine nucleotide exchange factor (GEF), which activates RAB6A by exchanging bound GDP for free GTP and may thereby required for efficient fusion of endosome-derived vesicles with the Golgi compartment. The RIC1-RGP1 complex participates in the recycling of mannose-6-phosphate receptors.
Research Articles on RGP1
Similar Products
Product Notes
The RGP1 rgp1 (Catalog #AAA1311639) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-391, Full length protein. The amino acid sequence is listed below: MIEVVAELSR GPVFLAGEAL ECVVTVTNPL PPTATSASSE ALAWASAQIH CQFHASESRV ALPPPDSSQP DVQPDSQTVF LPHRGERGQC ILSTPPKILF CDLRLDPGES KSYSYSEVLP IEGPPSFRGQ SVKYVYKLTI GCQRVNSPIT LLRVPLRVLV LTGLQDVRFP QDEAVAPSSP FLEEDEGGKK DSWLAELAGE RLMAATSCRS LHLYNISDGR GKVGTFGIFK SVYRLGEDVV GTLNLGEGTV ACLQFSVSLQ TEERVQPEYQ RRRGAGGVPS VSHVTHARHQ ESCLHTTRTS FSLPIPLSST PGFCTAIVSL KWRLHFEFVT SREPGLVLLP PVEQPEPTTW TGPEQVPVDT FSWDLPIKVL PTSPTLASYA APGPSTSTIT I. It is sometimes possible for the material contained within the vial of "Retrograde Golgi transport protein RGP1 homolog (RGP1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
