Replication factor C subunit 1 (Rfc1) Recombinant Protein | Rfc1 recombinant protein
Recombinant Mouse Replication factor C subunit 1 (Rfc1) , partial
Gene Names
Rfc1; Recc1; 140kDa; Alp145; RFC140
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Replication factor C subunit 1 (Rfc1); Recombinant Mouse Replication factor C subunit 1 (Rfc1); partial; Rfc1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
354-528. Partial, provide the Interferon-stimulated-response-element binding region including the BRCT domain
Sequence
TKVSPTKRESVSPEDSEKKRTNYQAYRSYLNREGPKALGSKEIPKGAENCLEGLTFVITGVLESIERDEAKSLIERYGGKVTGNVSKKTNYLVMGRDSGQSKSDKAAALGTKILDEDGLLDLIRTMPGKRSKYEMAAEAEMKKEKSKLERTPQKNDQGKRKISPAKKESESKKCK
Sequence Length
528
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Rfc1 recombinant protein
This protein is the large subunit of replication factor C, which is a five subunit DNA polymerase accessory protein. Replication factor C is a DNA-dependent ATPase that is required for eukaryotic DNA replication and repair. The protein acts as an activator of DNA polymerases, binds to the 3 end of primers, and promotes coordinated synthesis of both strands. It also may have a role in telomere stability.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
125,914 Da
NCBI Official Full Name
replication factor C subunit 1 isoform 2
NCBI Official Synonym Full Names
replication factor C (activator 1) 1
NCBI Official Symbol
Rfc1
NCBI Official Synonym Symbols
Recc1; 140kDa; Alp145; RFC140
NCBI Protein Information
replication factor C subunit 1
UniProt Protein Name
Replication factor C subunit 1
Protein Family
UniProt Gene Name
Rfc1
UniProt Synonym Gene Names
Ibf-1; Recc1; A1 140 kDa subunit; RF-C 140 kDa subunit; RFC140
Uniprot Description
The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins PCNA and activator 1. This subunit binds to the primer-template junction.
Similar Products
Product Notes
The Rfc1 rfc1 (Catalog #AAA949506) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 354-528. Partial, provide the Interferon-stimulated-response-element binding region including the BRCT domain . The amino acid sequence is listed below: TKVSPTKRES VSPEDSEKKR TNYQAYRSYL NREGPKALGS KEIPKGAENC LEGLTFVITG VLESIERDEA KSLIERYGGK VTGNVSKKTN YLVMGRDSGQ SKSDKAAALG TKILDEDGLL DLIRTMPGKR SKYEMAAEAE MKKEKSKLER TPQKNDQGKR KISPAKKESE SKKCK . It is sometimes possible for the material contained within the vial of "Replication factor C subunit 1 (Rfc1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
