Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Replicase polyprotein 1ab (rep) Recombinant Protein | orf1ab recombinant protein

Recombinant Human SARS coronavirus Replicase polyprotein 1ab (rep)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Replicase polyprotein 1ab (rep); Recombinant Human SARS coronavirus Replicase polyprotein 1ab (rep); Recombinant Replicase polyprotein 1ab (rep); Replicase polyprotein 1ab; pp1ab; ORF1ab polyprotein Cleaved into the following 15 chains: 1. Non-structural protein 1; 2. nsp1; Leader protein Non-structural protein 2; nsp2; p65 homolog Non-structural protein; orf1ab recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
6776-7073
Sequence
ASQAWQPGVAMPNLYKMQRMLLEKCDLQNYGENAVIPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTANKWDLIISDMYDPRTKHVTKENDSKEGFFTYLCGFIKQKLALGGSIAVKITEHSWNADLYKLMGHFSWWTAFVTNVNASSSEAFLIGANYLGKPKEQIDGYTMHANYIFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKENQINDMIYSLLEKGRLIIRENNRVVVSSDILVNN
Sequence Length
7073
Species
Human SARS coronavirus (SARS-CoV) (Severe acute respiratory syndrome coronavirus)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
790,248 Da
NCBI Official Full Name
orf1ab polyprotein (pp1ab)
NCBI Official Symbol
orf1ab
NCBI Protein Information
orf1ab polyprotein (pp1ab); orf1a polyprotein (pp1a); leader protein; counterpart of MHV p65; nsp3-pp1a/pp1ab; 3C-like proteinase; nsp6-pp1a/pp1ab (TM3); nsp7-pp1a/pp1ab; nsp8-pp1a/pp1ab; nsp9-pp1a/pp1ab; formerly known as growth-factor-like protein (GFL); RNA-dependent RNA polymerase; nsp13-pp1ab (ZD, NTPase/HEL; RNA 5'-triphosphatase); 3'-to-5' exonuclease; endoRNAse; 2'-O-ribose methyltransferase (2'-o-MT); nsp4-pp1a/pp1ab; nsp11-pp1a
UniProt Protein Name
Replicase polyprotein 1ab
UniProt Gene Name
rep
UniProt Synonym Gene Names
pp1ab; nsp1; nsp2; PL-PRO; nsp3; nsp4; 3CL-PRO; 3CLp; nsp6; nsp7; nsp8; nsp9; nsp10; GFL; Pol; RdRp; Hel; ExoN
UniProt Entry Name
R1AB_CVHSA

Uniprot Description

Function: The replicase polyprotein of coronaviruses is a multifunctional protein: it contains the activities necessary for the transcription of negative stranded RNA, leader RNA, subgenomic mRNAs and progeny virion RNA as well as proteinases responsible for the cleavage of the polyprotein into functional products

By similarity. Ref.30 Ref.31 Ref.32The papain-like proteinase (PL-PRO) is responsible for the cleavages located at the N-terminus of replicase polyprotein. In addition, PL-PRO possesses a deubiquitinating/deISGylating activity and processes both 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains from cellular substrates. Antagonizes innate immune induction of type I interferon by blocking the phosphorylation, dimerization and subsequent nuclear translocation of host IRF-3. Ref.30 Ref.31 Ref.32The main proteinase 3CL-PRO is responsible for the majority of cleavages as it cleaves the C-terminus of replicase polyprotein at 11 sites. Recognizes substrates containing the core sequence [ILMVF]-Q-|-[SGACN]. Inhibited by the substrate-analog Cbz-Val-Asn-Ser-Thr-Leu-Gln-CMK

By similarity. Also contains an ADP-ribose-1''-phosphate (ADRP)-binding function. Ref.30 Ref.31 Ref.32The helicase which contains a zinc finger structure displays RNA and DNA duplex-unwinding activities with 5' to 3' polarity. Its ATPase activity is strongly stimulated by poly(U), poly(dT), poly(C), poly(dA), but not by poly(G). Activity of helicase is dependent on magnesium. Ref.30 Ref.31 Ref.32The exoribonuclease acts on both ssRNA and dsRNA in a 3' to 5' direction. Ref.30 Ref.31 Ref.32Nsp7-nsp8 hexadecamer may possibly confer processivity to the polymerase, maybe by binding to dsRNA or by producing primers utilized by the latter. Ref.30 Ref.31 Ref.32Nsp9 is a ssRNA-binding protein. Ref.30 Ref.31 Ref.32NendoU is a Mn2+-dependent, uridylate-specific enzyme, which leaves 2'-3'-cyclic phosphates 5' to the cleaved bond. Ref.30 Ref.31 Ref.32

Catalytic activity: Nucleoside triphosphate + RNA(n) = diphosphate + RNA(n+1). Ref.25ATP + H2O = ADP + phosphate. Ref.25TSAVLQ-|-SGFRK-NH2 and SGVTFQ-|-GKFKK the two peptides corresponding to the two self-cleavage sites of the SARS 3C-like proteinase are the two most reactive peptide substrates. The enzyme exhibits a strong preference for substrates containing Gln at P1 position and Leu at P2 position. Ref.25Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal). Ref.25

Subunit structure: 3CL-PRO exists as monomer and homodimer. Only the homodimer shows catalytic activity. Eight copies of nsp7 and eight copies of nsp8 assemble to form a heterohexadecamer. Nsp9 is a dimer. Nsp10 forms a dodecamer

By similarity. Interacts (via N-terminus) with DDX1. Ref.25 Ref.33 Ref.38

Subcellular location: Non-structural protein 3: Host membrane; Multi-pass membrane protein

Potential. Non-structural protein 4: Host membrane; Multi-pass membrane protein

Potential. Non-structural protein 6: Host membrane; Multi-pass membrane protein

Potential. Non-structural protein 7: Host cytoplasm › host perinuclear region

By similarity. Note: nsp7, nsp8, nsp9 and nsp10 are localized in cytoplasmic foci, largely perinuclear. Late in infection, they merge into confluent complexes

By similarity.Non-structural protein 8: Host cytoplasm › host perinuclear region

By similarity. Note: nsp7, nsp8, nsp9 and nsp10 are localized in cytoplasmic foci, largely perinuclear. Late in infection, they merge into confluent complexes

By similarity.Non-structural protein 9: Host cytoplasm › host perinuclear region

By similarity. Note: nsp7, nsp8, nsp9 and nsp10 are localized in cytoplasmic foci, largely perinuclear. Late in infection, they merge into confluent complexes

By similarity.Non-structural protein 10: Host cytoplasm › host perinuclear region

By similarity. Note: nsp7, nsp8, nsp9 and nsp10 are localized in cytoplasmic foci, largely perinuclear. Late in infection, they merge into confluent complexes

By similarity.Helicase: Host endoplasmic reticulum-Golgi intermediate compartment

Potential. Note: The helicase interacts with the N protein in membranous complexes and colocalizes with sites of synthesis of new viral RNA

By similarity.Uridylate-specific endoribonuclease: Host cytoplasm › host perinuclear region

By similarity.

Domain: The hydrophobic domains (HD) could mediate the membrane association of the replication complex and thereby alter the architecture of the host cell membrane. Ref.25

Post-translational modification: Specific enzymatic cleavages in vivo by its own proteases yield mature proteins. 3CL-PRO and PL-PRO proteinases are autocatalytically processed

By similarity.

Sequence similarities: Belongs to the coronaviruses polyprotein 1ab family.Contains 1 (+)RNA virus helicase ATP-binding domain.Contains 1 (+)RNA virus helicase C-terminal domain.Contains 1 CV MBD (coronavirus metal-binding) domain.Contains 1 Macro domain.Contains 1 peptidase C16 domain.Contains 1 peptidase C30 domain.Contains 1 RdRp catalytic domain.

Caution: Isolates SZ3 and SZ16 have been isolated from Paguma larvata and are described as SARS-like in litterature.

Biophysicochemical propertiesKinetic parameters:The kinetic parameters are studied for the 3C-like proteinase domain. The cleavage takes place at the /.KM=1.15 mM for peptide TSAVLQ/SGFRK-NH2 Ref.25KM=0.58 mM for peptide SGVTFQ/GKFKKKM=1.44 mM for peptide ATVRLQ/AGNATpH dependence:Optimum pH is 7.0 for 3C-like proteinase activity.

Sequence caution: The sequence AAP13440.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAP41036.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAP82975.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAP97881.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAQ01596.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAQ01608.1 differs from that shown. Reason: Erroneous gene model prediction.

Research Articles on orf1ab

Similar Products

Product Notes

The orf1ab rep (Catalog #AAA1058571) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 6776-7073. The amino acid sequence is listed below: ASQAWQPGVA MPNLYKMQRM LLEKCDLQNY GENAVIPKGI MMNVAKYTQL CQYLNTLTLA VPYNMRVIHF GAGSDKGVAP GTAVLRQWLP TGTLLVDSDL NDFVSDADST LIGDCATVHT ANKWDLIISD MYDPRTKHVT KENDSKEGFF TYLCGFIKQK LALGGSIAVK ITEHSWNADL YKLMGHFSWW TAFVTNVNAS SSEAFLIGAN YLGKPKEQID GYTMHANYIF WRNTNPIQLS SYSLFDMSKF PLKLRGTAVM SLKENQINDM IYSLLEKGRL IIRENNRVVV SSDILVNN. It is sometimes possible for the material contained within the vial of "Replicase polyprotein 1ab (rep), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.