Tumor necrosis factor receptor superfamily member 19L Recombinant Protein | RELT recombinant protein

Recombinant Human Tumor necrosis factor receptor superfamily member 19L protein

Cat. Num. AAA1265334

• Gene Names: RELT; TRLT; TNFRSF19L
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Tumor necrosis factor receptor superfamily member 19L; Recombinant Human Tumor necrosis factor receptor superfamily member 19L protein; Receptor expressed in lymphoid tissues; RELT recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 26-153aa; Partial
• Sequence: STTLWQCPPGEEPDLDPGQGTLCRPCPPGTFSAAWGSSPCQPHARCSLWRRLEAQVGMATRDTLCGDCWPGWFGPWGVPRVPCQPCSWAPLGTHGCDEWGRRARRGVEVAAGASSGGETRQPGNGTRA
• Sequence Length: 430

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for RELT recombinant protein

Mediates activation of NF-kappa-B. May play a role in T-cell activation.

Product Categories/Family for RELT recombinant protein

Signal Transduction

References

RELT, a new member of the tumor necrosis factor receptor superfamily, is selectively expressed in hematopoietic tissues and activates transcription factor NF-kappaB.Sica G.L., Zhu G., Tamada K., Liu D., Ni J., Chen L.Blood 97:2702-2707(2001) Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) The nucleotide sequence of a long cDNA clone isolated from human spleen.Jikuya H., Takano J., Nomura N., Kikuno R., Nagase T., Ohara O. Signal peptide prediction based on analysis of experimentally verified cleavage sites.Zhang Z., Henzel W.J.Protein Sci. 13:2819-2824(2004) Identification of RELT homologues that associate with RELT and are phosphorylated by OSR1.Cusick J.K., Xu L.-G., Bin L.-H., Han K.-J., Shu H.-B.Biochem. Biophys. Res. Commun. 340:535-543(2006)

NCBI and Uniprot Product Information

• NCBI GI #: 21361873
• NCBI GeneID: 84957
• NCBI Accession #: NP_116260.2
• NCBI GenBank Nucleotide #: NM_032871.3
• UniProt Accession #: Q969Z4; Q86V34; Q96JU1; Q9BUX7
• Molecular Weight: 17.7 kDa
• NCBI Official Full Name: tumor necrosis factor receptor superfamily member 19L
• NCBI Official Synonym Full Names: RELT tumor necrosis factor receptor
• NCBI Official Symbol: RELT
• NCBI Official Synonym Symbols: TRLT; TNFRSF19L
• NCBI Protein Information: tumor necrosis factor receptor superfamily member 19L
• UniProt Protein Name: Tumor necrosis factor receptor superfamily member 19L
• Protein Family: Tumor necrosis factor receptor superfamily
• UniProt Gene Name: RELT
• UniProt Synonym Gene Names: TNFRSF19L
• UniProt Entry Name: TR19L_HUMAN

NCBI Description

The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is especially abundant in hematologic tissues. It has been shown to activate the NF-kappaB pathway and selectively bind TNF receptor-associated factor 1 (TRAF1). This receptor is capable of stimulating T-cell proliferation in the presence of CD3 signaling, which suggests its regulatory role in immune response. Two alternatively spliced transcript variants of this gene encoding the same protein have been reported. [provided by RefSeq, Jul 2008]

Uniprot Description

RELT: Mediates activation of NF-kappa-B. May play a role in T- cell activation. Belongs to the RELT family.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 11q13.4

Cellular Component: cytoplasm; integral to plasma membrane

Molecular Function: tumor necrosis factor receptor activity

Biological Process: immune response; inflammatory response; multicellular organismal development; positive regulation of MAPKKK cascade; regulation of apoptosis; regulation of cell proliferation; response to lipopolysaccharide; tumor necrosis factor-mediated signaling pathway