Pre-60S factor REI1 (REI1) Recombinant Protein | REI1 recombinant protein
Recombinant Saccharomyces cerevisiae Pre-60S factor REI1 (REI1)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Pre-60S factor REI1 (REI1); Recombinant Saccharomyces cerevisiae Pre-60S factor REI1 (REI1); REI1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-393, full length protein
Sequence
MSSSGVYTCNSCVLTFDSSDEQRAHMKSDWHRYNLKRRVAQLPPISFETFDSKVSAAAASTSKSAEKEKPVTKKELKRREKQALLEKKKKLLEIARANMLENMQKSQEGNTPDLSKLSLQENEENKEKEEPKKEEPEQLTEEEMAERVMQEKLRNRVDIPLEQCLFCEHNKHFKDVEENLEHMFRTHGFYIPEQKYLVDKIGLVKYMSEKIGLGNICIVCNYQGRTLTAVRQHMLAKRHCKIPYESEDERLEISEFYDFTSSYANFNSNTTPDNEDDWEDVGSDEAGSDDEDLPQEYLYNDGIELHLPTGIKVGHRSLQRYYKQDLKPEVILTEGQGTLVAAETRSFLPAFDKKGVQTQQRVWQTERFDKKRLDKRSAKFVNNQPHYRDQLLQ
Sequence Length
393
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
45,862 Da
NCBI Official Full Name
Rei1p
NCBI Official Symbol
REI1
NCBI Protein Information
Rei1p
UniProt Protein Name
Cytoplasmic 60S subunit biogenesis factor REI1
Protein Family
UniProt Gene Name
REI1
Uniprot Description
Pre-60S-associated factor involved in the cytoplasmic maturation of the 60S subunit. Involved in the dissociation and recycling of other late pre-60S factors like ARX1, TIF6 and ALB1 before newly synthesized large ribosomal subunits enter translation. Cooperates with the co-chaperone JJJ1 in the release of the nuclear-export factor ARX1. May act redundantly with REH1 to directly promote a stabilizing structural rearrangement in cytoplasmic 60S subunit maturation independent on ARX1 recycling.
Research Articles on REI1
Similar Products
Product Notes
The REI1 rei1 (Catalog #AAA1130965) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-393, full length protein. The amino acid sequence is listed below: MSSSGVYTCN SCVLTFDSSD EQRAHMKSDW HRYNLKRRVA QLPPISFETF DSKVSAAAAS TSKSAEKEKP VTKKELKRRE KQALLEKKKK LLEIARANML ENMQKSQEGN TPDLSKLSLQ ENEENKEKEE PKKEEPEQLT EEEMAERVMQ EKLRNRVDIP LEQCLFCEHN KHFKDVEENL EHMFRTHGFY IPEQKYLVDK IGLVKYMSEK IGLGNICIVC NYQGRTLTAV RQHMLAKRHC KIPYESEDER LEISEFYDFT SSYANFNSNT TPDNEDDWED VGSDEAGSDD EDLPQEYLYN DGIELHLPTG IKVGHRSLQR YYKQDLKPEV ILTEGQGTLV AAETRSFLPA FDKKGVQTQQ RVWQTERFDK KRLDKRSAKF VNNQPHYRDQ LLQ. It is sometimes possible for the material contained within the vial of "Pre-60S factor REI1 (REI1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
