Sensor histidine kinase regB (regB) Recombinant Protein | regB recombinant protein
Recombinant Rhodobacter sphaeroides Sensor histidine kinase regB (regB)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Sensor histidine kinase regB (regB); Recombinant Rhodobacter sphaeroides Sensor histidine kinase regB (regB); regB recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-462aa; full length protein
Sequence
MILGPDGILNRDTRGDWVRLRTLILLRWMAVAGQLAAIVVTDWYLGVRLPMGLCFMAVGA SVIANVIATFVFPQNRRLTEFQALMILLFDLTQLSFLLFLTGGLTNPFALLILAPVTISA LALELRTTVILGAIAIGLLTFTAYFHLPLILADGSSLSVPRMFEFGFWLAIVIGILFLGL YSRRVAIEIRSMSDALLATQMALDREQKLTDLGGVVAAAAHELGTPLATIKLVSSELAEE LSEQPALRDDAELIREQADRCRDILRSMGRAGKDDLQMRQAPLGEVLREAAEPHVGRGKR VEFDLYPSRGGDERQPVILRRPEVIHGLRNLIQNAVDFARSTVWIDGEWTGDRIAIRIVD DGEGYPPAIIGRIGDPFVRQRRAEESQSRRPGYEGMGLGLFIAKTLLERSGAELSFANAA DPFLRSHERPERCGAIVEVIWPVDRLVVVRNAPLGENVLIQT
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for regB recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
51,033 Da
NCBI Official Full Name
MULTISPECIES: two-component sensor histidine kinase
NCBI Official Symbol
prrB
NCBI Protein Information
Sensor histidine kinase PrrB (RegB)
UniProt Protein Name
Sensor histidine kinase RegB
Protein Family
UniProt Gene Name
regB
UniProt Synonym Gene Names
prrB
UniProt Entry Name
REGB_RHOS4
Uniprot Description
Member of the two-component regulatory system RegB/RegA. Involved in the positive regulation of photosynthesis gene expression in response to anaerobiosis. Also involved in positive regulation of the cbbI and cbbII Calvin cycle CO2 fixation operons, as well as in regulation of expression of genes involved in alternative CO2 fixation pathways. Phosphorylates RegA/PrrA.
Research Articles on regB
Similar Products
Product Notes
The regB regb (Catalog #AAA7028487) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-462aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the regB regb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MILGPDGILN RDTRGDWVRL RTLILLRWMA VAGQLAAIVV TDWYLGVRLP MGLCFMAVGA SVIANVIATF VFPQNRRLTE FQALMILLFD LTQLSFLLFL TGGLTNPFAL LILAPVTISA LALELRTTVI LGAIAIGLLT FTAYFHLPLI LADGSSLSVP RMFEFGFWLA IVIGILFLGL YSRRVAIEIR SMSDALLATQ MALDREQKLT DLGGVVAAAA HELGTPLATI KLVSSELAEE LSEQPALRDD AELIREQADR CRDILRSMGR AGKDDLQMRQ APLGEVLREA AEPHVGRGKR VEFDLYPSRG GDERQPVILR RPEVIHGLRN LIQNAVDFAR STVWIDGEWT GDRIAIRIVD DGEGYPPAII GRIGDPFVRQ RRAEESQSRR PGYEGMGLGL FIAKTLLERS GAELSFANAA DPFLRSHERP ERCGAIVEVI WPVDRLVVVR NAPLGENVLI QT. It is sometimes possible for the material contained within the vial of "Sensor histidine kinase regB (regB), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
