Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Mouse anti-Human SDS Monoclonal Antibody | anti-SDS antibody

SDS (L-serine Dehydratase/L-threonine Deaminase, SDH, L-serine Deaminase, L-threonine Dehydratase, TDH) APC

Gene Names
SDS; SDH
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SDS; Monoclonal Antibody; SDS (L-serine Dehydratase/L-threonine Deaminase; SDH; L-serine Deaminase; L-threonine Dehydratase; TDH) APC; EC=4.3.1.17; EC=4.3.1.19; anti-SDS antibody
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1A9
Specificity
Recognizes human SDS.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-SDS antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-219 from human SDS (AAH20750) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MMSGEPLHVKTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQGCAHFVCSSAGNAGMAAAYAARQLGVPATIVVPSTTPALTIERLKNEGATVKVVGELLDEAFELAKALAKNNPGWVYIPPFDDPLIWEGHASIVKELKETLWEKPGAIALSVGGGGLLCGVVQGLQEVGWGDVPVIAMETFGAHSFHAATTAGKLVSLPKITR
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (50.09kD).)

SDS-Page

(Detection limit for recombinant GST tagged SDS is 0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-SDS antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
34,625 Da
NCBI Official Full Name
Homo sapiens serine dehydratase, mRNA
NCBI Official Synonym Full Names
serine dehydratase
NCBI Official Symbol
SDS
NCBI Official Synonym Symbols
SDH
NCBI Protein Information
L-serine dehydratase/L-threonine deaminase

NCBI Description

This gene encodes one of three enzymes that are involved in metabolizing serine and glycine. L-serine dehydratase converts L-serine to pyruvate and ammonia and requires pyridoxal phosphate as a cofactor. The encoded protein can also metabolize threonine to NH4+ and 2-ketobutyrate. The encoded protein is found predominantly in the liver. [provided by RefSeq, Jul 2008]

Research Articles on SDS

Similar Products

Product Notes

The SDS (Catalog #AAA6138951) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SDS (L-serine Dehydratase/L-threonine Deaminase, SDH, L-serine Deaminase, L-threonine Dehydratase, TDH) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SDS can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SDS for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SDS, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual