RNA-binding protein 14 (RBM14) Recombinant Protein | RBM14 recombinant protein

Recombinant Human RNA-binding protein 14 (RBM14)

Gene Names

RBM14; SIP; COAA; PSP2; SYTIP1; TMEM137

Purity

Greater or equal to 85% purity as determined by SDS-PAGE.

Synonyms

RNA-binding protein 14 (RBM14); Recombinant Human RNA-binding protein 14 (RBM14); RNA-binding protein 14; Paraspeckle protein 2; PSP2; RNA-binding motif protein 14; RRM-containing coactivator activator/modulator; Synaptotagmin-interacting protein; SYT-interacting protein; RBM14 recombinant protein

Ordering
Cat. Num. AAA1365325 For Research Use Only!

Host

E Coli or Yeast or Baculovirus or Mammalian Cell

Purity/Purification

Greater or equal to 85% purity as determined by SDS-PAGE.

Form/Format

Lyophilized or liquid (Format to be determined during the manufacturing process)

Sequence Positions

1-669, Full length protein

Sequence

MKIFVGNVDGADTTPEELAALFAPYGTVMSCAVMKQFAFVHMRENAGALRAIEALHGHELRPGRALVVEMSRPRPLNTWKIFVGNVSAACTSQELRSLFERRGRVIECDVVKDYAFVHMEKEADAKAAIAQLNGKEVKGKRINVELSTKGQKKGPGLAVQSGDKTKKPGAGDTAFPGTGGFSATFDYQQAFGNSTGGFDGQARQPTPPFFGRDRSPLRRSPPRASYVAPLTAQPATYRAQPSVSLGAAYRAQPSASLGVGYRTQPMTAQAASYRAQPSVSLGAPYRGQLASPSSQSAAASSLGPYGGAQPSASALSSYGGQAAAASSLNSYGAQGSSLASYGNQPSSYGAQAASSYGVRAAASSYNTQGAASSLGSYGAQAASYGAQSAASSLAYGAQAASYNAQPSASYNAQSAPYAAQQAASYSSQPAAYVAQPATAAAYASQPAAYAAQATTPMAGSYGAQPVVQTQLNSYGAQASMGLSGSYGAQSAAAATGSYGAAAAYGAQPSATLAAPYRTQSSASLAASYAAQQHPQAAASYRGQPGNAYDGAGQPSAAYLSMSQGAVANANSTPPPYERTRLSPPRASYDDPYKKAVAMSKRYGSDRRLAELSDYRRLSESQLSFRRSPTKSSLDYRRLPDAHSDYARYSGSYNDYLRAAQMHSGYQRRM

Sequence Length

669

Species

Homo sapiens (Human)

Preparation and Storage

Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for RBM14 recombinant protein

Isoform 1 may function as a nuclear receptor coactivator, enhancing transcription through other coactivators such as NCOA6 and CITED1. Isoform 2, functions as a transcriptional repressor, modulating transcriptional activities of coactivators including isoform 1, NCOA6 and CITED1.

NCBI and Uniprot Product Information

NCBI GI #

311771525

NCBI GeneID

10432

NCBI Accession #

NP_001185765.1

NCBI GenBank Nucleotide #

NM_001198836.1

UniProt Accession #

Q96PK6; O75932; Q2PYN1; Q53GV1; Q68DQ9; Q96PK5; B0LM41; B3KMN4; D6RGD8

Molecular Weight

37,035 Da

NCBI Official Full Name

RNA-binding protein 14 isoform 2

NCBI Official Synonym Full Names

RNA binding motif protein 14

NCBI Official Symbol

RBM14

NCBI Official Synonym Symbols

SIP; COAA; PSP2; SYTIP1; TMEM137

NCBI Protein Information

RNA-binding protein 14; paraspeckle protein 2; SYT-interacting protein; transmembrane protein 137; synaptotagmin-interacting protein; RRM-containing coactivator activator/modulator

UniProt Protein Name

RNA-binding protein 14

Protein Family

RNA-binding protein

UniProt Gene Name

RBM14

UniProt Synonym Gene Names

SIP; PSP2; SYT-interacting protein

UniProt Entry Name

RBM14_HUMAN

NCBI Description

This gene encodes a ribonucleoprotein that functions as a general nuclear coactivator, and an RNA splicing modulator. This protein contains two RNA recognition motifs (RRM) at the N-terminus, and multiple hexapeptide repeat domain at the C-terminus that interacts with thyroid hormone receptor-binding protein (TRBP), and is required for transcription activation. Alternatively spliced transcript variants encoding different isoforms (with opposing effects on transcription) have been described for this gene. [provided by RefSeq, Oct 2011]

Uniprot Description

RBM14: an RNA binding protein and transcriptional regulator. Expressed in all tissues tested, including brain, heart, skeletal muscle, colon, thymus, spleen, kidney, liver, small intestine, placenta, lung and peripheral blood lymphocytes. Two alternatively spliced isoforms have been observed. Isoform 1 may function as a nuclear receptor coactivator, enhancing transcription through other coactivators such as NCOA6 and CITED1. Isoform 2, functions as a transcriptional repressor, modulating transcriptional activities of coactivators including isoform 1, NCOA6 and CITED1.

Protein type: Nuclear receptor co-regulator; Nucleolus; RNA-binding

Chromosomal Location of Human Ortholog: 11q13.2

Cellular Component: nucleoplasm; transcription factor complex; nucleolus; Srb-mediator complex; ribonucleoprotein complex

Molecular Function: protein binding, bridging; protein binding; ligand-dependent nuclear receptor transcription coactivator activity; RNA binding; nucleotide binding

Biological Process: transcription from RNA polymerase II promoter; estrogen receptor signaling pathway; glucocorticoid receptor signaling pathway; response to hormone stimulus; positive regulation of transcription from RNA polymerase II promoter; histone deacetylation; DNA replication; DNA repair; DNA recombination

Research Articles on RBM14

1. CoAA is involved in the migration-enhancing action of PEA3 on MCF7 metastatic human cancer cells.

Similar Products

Product Notes

The RBM14 rbm14 (Catalog #AAA1365325) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-669, Full length protein. The amino acid sequence is listed below: MKIFVGNVDG ADTTPEELAA LFAPYGTVMS CAVMKQFAFV HMRENAGALR AIEALHGHEL RPGRALVVEM SRPRPLNTWK IFVGNVSAAC TSQELRSLFE RRGRVIECDV VKDYAFVHME KEADAKAAIA QLNGKEVKGK RINVELSTKG QKKGPGLAVQ SGDKTKKPGA GDTAFPGTGG FSATFDYQQA FGNSTGGFDG QARQPTPPFF GRDRSPLRRS PPRASYVAPL TAQPATYRAQ PSVSLGAAYR AQPSASLGVG YRTQPMTAQA ASYRAQPSVS LGAPYRGQLA SPSSQSAAAS SLGPYGGAQP SASALSSYGG QAAAASSLNS YGAQGSSLAS YGNQPSSYGA QAASSYGVRA AASSYNTQGA ASSLGSYGAQ AASYGAQSAA SSLAYGAQAA SYNAQPSASY NAQSAPYAAQ QAASYSSQPA AYVAQPATAA AYASQPAAYA AQATTPMAGS YGAQPVVQTQ LNSYGAQASM GLSGSYGAQS AAAATGSYGA AAAYGAQPSA TLAAPYRTQS SASLAASYAA QQHPQAAASY RGQPGNAYDG AGQPSAAYLS MSQGAVANAN STPPPYERTR LSPPRASYDD PYKKAVAMSK RYGSDRRLAE LSDYRRLSES QLSFRRSPTK SSLDYRRLPD AHSDYARYSG SYNDYLRAAQ MHSGYQRRM. It is sometimes possible for the material contained within the vial of "RNA-binding protein 14 (RBM14), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.