Glycine-rich RNA-binding protein 8 (GRP8) Recombinant Protein | GRP8 recombinant protein

Recombinant Arabidopsis thaliana Glycine-rich RNA-binding protein 8 (GRP8)

Cat. Num. AAA1028594

• Gene Names: CCR1; and RNA binding 1; ATGRP8; circadian rhythm; cold; GLYCINE-RICH PROTEIN 8; glycine-rich RNA-binding protein 8; GR-RBP8; GRP8; T22F8.160; T22F8_160
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Glycine-rich RNA-binding protein 8 (GRP8); Recombinant Arabidopsis thaliana Glycine-rich RNA-binding protein 8 (GRP8); GRP8 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-169, Full length protein
• Sequence: MSEVEYRCFVGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKDEKAMRDAIEEMNGKELDGRVITVNEAQSRGSGGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGYERRSGGYGSGGGGGGRGYGGGGRREGGGYGGGDGGSYGGGGGGW
• Sequence Length: 169

• Species: Arabidopsis thaliana (Mouse-ear cress)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 15235002
• NCBI GeneID: 830082
• NCBI Accession #: NP_195637.1
• NCBI GenBank Nucleotide #: NM_120087.4
• UniProt Accession #: Q03251; Q94CB0
• Molecular Weight: 5,884 Da
• NCBI Official Full Name: cold, circadian rhythm, and RNA binding 1
• NCBI Official Symbol: CCR1
• NCBI Official Synonym Symbols: and RNA binding 1; ATGRP8; circadian rhythm; cold; GLYCINE-RICH PROTEIN 8; glycine-rich RNA-binding protein 8; GR-RBP8; GRP8; T22F8.160; T22F8_160
• NCBI Protein Information: cold, circadian rhythm, and RNA binding 1
• UniProt Protein Name: Glycine-rich RNA-binding protein 8
• UniProt Gene Name: RBG8
• UniProt Synonym Gene Names: CCR1; GR-RBP8; GRP8; AtGR-RBP8; AtGRP8; Protein CCR1

NCBI Description

Encodes a glycine-rich protein with RNA binding domain at the N-terminus. Protein is structurally similar to proteins induced by stress in other plants. Gene expression is induced by cold. Transcript undergoes circadian oscillations that is depressed by overexpression of AtGRP7. A substrate of the type III effector HopU1 (mono-ADP-ribosyltransferase).

Uniprot Description

Plays a role in RNA transcription or processing during stress. Binds RNAs and DNAs sequence with a preference to single-stranded nucleic acids. Involved in mRNA alternative splicing of numerous targets by modulating splice site selection. Negatively regulates the circadian oscillations of its own transcript as well as RBG7 transcript. Forms an interlocked post-transcriptional negative feedback loop with the RBG7 autoregulatory circuit. Both proteins negatively autoregulate and reciprocally crossregulate by binding to their pre-mRNAs and promoting unproductive splicing coupled to degradation via the NMD pathway. Target of the Pseudomonas syringae type III effector HopU1.