Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

TOMT blocking peptide

TOMT Peptide - middle region

Gene Names
Tomt; Comt2; F930017I19Rik
Reactivity
Rat
Synonyms
TOMT; TOMT Peptide - middle region; TOMT blocking peptide
Ordering
For Research Use Only!
Reactivity
Rat
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: FSYVLTHALPGDPGHILTTLDHWSSCCEYLSHMGPVKGQILMRLVEEKAP
Sequence Length
258
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for TOMT blocking peptide
This is a synthetic peptide designed for use in combination with anti- TOMT Antibody, made

Target Description: Catalyzes the O-methylation, and thereby the inactivation, of catecholamine neurotransmitters and catechol hormones (By similarity). Required for auditory function (By similarity). Component of the cochlear hair cell's mechanotransduction (MET) machinery. Involved in the assembly of the asymmetric tip-link MET complex. Required for transportation of TMC1 and TMC2 proteins into the mechanically sensitive stereocilia of the hair cells. The function in MET is independent of the enzymatic activity (By similarity).
Product Categories/Family for TOMT blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29 kDa
NCBI Official Full Name
transmembrane O-methyltransferase homolog
NCBI Official Synonym Full Names
transmembrane O-methyltransferase
NCBI Official Symbol
Tomt
NCBI Official Synonym Symbols
Comt2; F930017I19Rik
NCBI Protein Information
transmembrane O-methyltransferase homolog; transmembrane O-methyltransferase
UniProt Protein Name
Transmembrane O-methyltransferase homolog
UniProt Gene Name
Tomt

Uniprot Description

Catalyzes the O-methylation, and thereby the inactivation, of catecholamine neurotransmitters and catechol hormones (). Required for auditory function (). Component of the cochlear hair cell's mechanotransduction (MET) machinery. Involved in the assembly of the asymmetric tip-link MET complex. Required for transportation of TMC1 and TMC2 proteins into the mechanically sensitive stereocilia of the hair cells. The function in MET is independent of the enzymatic activity ().

Research Articles on TOMT

Similar Products

Product Notes

The TOMT tomt (Catalog #AAA3248404) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The TOMT Peptide - middle region reacts with Rat and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: FSYVLTHALP GDPGHILTTL DHWSSCCEYL SHMGPVKGQI LMRLVEEKAP. It is sometimes possible for the material contained within the vial of "TOMT, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.