Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

KCNJ14 blocking peptide

KCNJ14 Peptide - middle region

Gene Names
Kcnj14; Kir2.4
Reactivity
Rat
Synonyms
KCNJ14; KCNJ14 Peptide - middle region; KCNJ14 blocking peptide
Ordering
For Research Use Only!
Reactivity
Rat
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: YIPLDHQDVDVGFDGGTDRIFLVSPITIVHEIDSASPLYELGRAELARADF
Sequence Length
434
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for KCNJ14 blocking peptide
This is a synthetic peptide designed for use in combination with anti- KCNJ14 Antibody, made

Target Description: Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. KCNJ14 gives rise to low-conductance channels with a low affinity to the channel blockers Barium and Cesium.
Product Categories/Family for KCNJ14 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48 kDa
NCBI Official Full Name
ATP-sensitive inward rectifier potassium channel 14
NCBI Official Synonym Full Names
potassium voltage-gated channel subfamily J member 14
NCBI Official Symbol
Kcnj14
NCBI Official Synonym Symbols
Kir2.4
NCBI Protein Information
ATP-sensitive inward rectifier potassium channel 14
UniProt Protein Name
ATP-sensitive inward rectifier potassium channel 14
UniProt Gene Name
Kcnj14
UniProt Synonym Gene Names
Irk4; IRK-4
UniProt Entry Name
KCJ14_RAT

NCBI Description

inwardly rectifying K+ channel; involved in controlling excitability of motoneurons [RGD, Feb 2006]

Similar Products

Product Notes

The KCNJ14 kcnj14 (Catalog #AAA3248379) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The KCNJ14 Peptide - middle region reacts with Rat and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: YIPLDHQDVD VGFDGGTDRI FLVSPITIVH EIDSASPLYE LGRAELARAD F. It is sometimes possible for the material contained within the vial of "KCNJ14, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.