Western Blot (WB)
(Host: RabbitTarget Name: KCNJ14Sample Tissue: Rat Small Intestine lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Rat KCNJ14 Polyclonal Antibody | anti-KCNJ14 antibody
KCNJ14 Antibody - middle region
Gene Names
Kcnj14; Kir2.4
Reactivity
Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
KCNJ14; Polyclonal Antibody; KCNJ14 Antibody - middle region; anti-KCNJ14 antibody
Host
Rabbit
Reactivity
Rat
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YIPLDHQDVDVGFDGGTDRIFLVSPITIVHEIDSASPLYELGRAELARADF
Sequence Length
434
Applicable Applications for anti-KCNJ14 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of rat KCNJ14
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: KCNJ14Sample Tissue: Rat Small Intestine lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: KCNJ14Sample Tissue: Rat Small Intestine lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-KCNJ14 antibody
Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. KCNJ14 gives rise to low-conductance channels with a low affinity to the channel blockers Barium and Cesium.
Product Categories/Family for anti-KCNJ14 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48 kDa
NCBI Official Full Name
ATP-sensitive inward rectifier potassium channel 14
NCBI Official Synonym Full Names
potassium voltage-gated channel subfamily J member 14
NCBI Official Symbol
Kcnj14
NCBI Official Synonym Symbols
Kir2.4
NCBI Protein Information
ATP-sensitive inward rectifier potassium channel 14
UniProt Protein Name
ATP-sensitive inward rectifier potassium channel 14
Protein Family
UniProt Gene Name
Kcnj14
UniProt Synonym Gene Names
Irk4; IRK-4
UniProt Entry Name
KCJ14_RAT
NCBI Description
inwardly rectifying K+ channel; involved in controlling excitability of motoneurons [RGD, Feb 2006]
Similar Products
Product Notes
The KCNJ14 kcnj14 (Catalog #AAA3223798) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KCNJ14 Antibody - middle region reacts with Rat and may cross-react with other species as described in the data sheet. AAA Biotech's KCNJ14 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KCNJ14 kcnj14 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YIPLDHQDVD VGFDGGTDRI FLVSPITIVH EIDSASPLYE LGRAELARAD F. It is sometimes possible for the material contained within the vial of "KCNJ14, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
