Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

AKR1D1 blocking peptide

AKR1D1 Peptide - middle region

Gene Names
AKR1D1; CBAS2; SRD5B1; 3o5bred
Reactivity
Rat
Synonyms
AKR1D1; AKR1D1 Peptide - middle region; AKR1D1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Rat
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: CATSVKVAIDTGYRHIDGAYIYQNEHEVGEAIREKIAEGKVRREDIFYCG
Sequence Length
326
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for AKR1D1 blocking peptide
This is a synthetic peptide designed for use in combination with anti- AKR1D1 Antibody, made

Target Description: The enzyme encoded by this gene is responsible for the catalysis of the 5-beta-reduction of bile acid intermediates and steroid hormones carrying a delta(4)-3-one structure. Deficiency of this enzyme may contribute to hepatic dysfunction. Three transcript variants encoding different isoforms have been found for this gene. Other variants may be present, but their full-length natures have not been determined yet.
Product Categories/Family for AKR1D1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35 kDa
NCBI Official Full Name
3-oxo-5-beta-steroid 4-dehydrogenase isoform 2
NCBI Official Synonym Full Names
aldo-keto reductase family 1 member D1
NCBI Official Symbol
AKR1D1
NCBI Official Synonym Symbols
CBAS2; SRD5B1; 3o5bred
NCBI Protein Information
3-oxo-5-beta-steroid 4-dehydrogenase
UniProt Protein Name
3-oxo-5-beta-steroid 4-dehydrogenase
UniProt Gene Name
AKR1D1
UniProt Synonym Gene Names
SRD5B1
UniProt Entry Name
AK1D1_HUMAN

NCBI Description

The enzyme encoded by this gene is responsible for the catalysis of the 5-beta-reduction of bile acid intermediates and steroid hormones carrying a delta(4)-3-one structure. Deficiency of this enzyme may contribute to hepatic dysfunction. Three transcript variants encoding different isoforms have been found for this gene. Other variants may be present, but their full-length natures have not been determined yet. [provided by RefSeq, Jul 2010]

Uniprot Description

AKR1D1: Efficiently catalyzes the reduction of progesterone, androstenedione, 17-alpha-hydroxyprogesterone and testosterone to 5-beta-reduced metabolites. The bile acid intermediates 7- alpha,12-alpha-dihydroxy-4-cholesten-3-one and 7-alpha-hydroxy-4- cholesten-3-one can also act as substrates. Defects in AKR1D1 are the cause of congenital bile acid synthesis defect type 2 (CBAS2); also known as cholestasis with delta(4)-3-oxosteroid 5-beta-reductase deficiency. Patients with this liver disease show absence or low levels of chenodeoxycholic acid and cholic acid in plasma and urine. Belongs to the aldo/keto reductase family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 1.3.1.3; Lipid Metabolism - C21-steroid hormone; Lipid Metabolism - androgen and estrogen; Lipid Metabolism - primary bile acid biosynthesis; Oxidoreductase

Chromosomal Location of Human Ortholog: 7q32-q33

Cellular Component: cytosol

Molecular Function: aldo-keto reductase activity; steroid binding

Biological Process: androgen metabolic process; bile acid biosynthetic process; C21-steroid hormone metabolic process; cholesterol catabolic process; digestion

Disease: Bile Acid Synthesis Defect, Congenital, 2

Research Articles on AKR1D1

Similar Products

Product Notes

The AKR1D1 akr1d1 (Catalog #AAA3248473) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The AKR1D1 Peptide - middle region reacts with Rat and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: CATSVKVAID TGYRHIDGAY IYQNEHEVGE AIREKIAEGK VRREDIFYCG. It is sometimes possible for the material contained within the vial of "AKR1D1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.