Retinoic acid receptor beta (RARB) Recombinant Protein | RARB recombinant protein
Recombinant Chicken Retinoic acid receptor beta (RARB)
Gene Names
RARB; RARBETA
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Retinoic acid receptor beta (RARB); Recombinant Chicken Retinoic acid receptor beta (RARB); RARB recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-455, Full length protein
Sequence
MTTSSRTCPVPAVNGHMTHYPAAPYPLLFPPVIGGLSLPSLHGLQSHPPTSGCSTPSPATVETQSTSSEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEPTKQESTENYEMTAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLPGFTSLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPMKVDKLQEPLLEALKIYIRKRRPNKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPTSNGNTAEHSPSISPSSVDNSSVSQSPMVQ
Sequence Length
455
Species
Chicken
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for RARB recombinant protein
This gene encodes retinoic acid receptor beta, a member of the thyroid-steroid hormone receptor superfamily of nuclear transcriptional regulators. This receptor localizes to the cytoplasm and to subnuclear compartments. It binds retinoic acid, the biologically active form of vitamin A which mediates cellular signalling in embryonic morphogenesis, cell growth and differentiation. It is thought that this protein limits growth of many cell types by regulating gene expression. The gene was first identified in a hepatocellular carcinoma where it flanks a hepatitis B virus integration site. The gene expresses at least two transcript variants; one additional transcript has been described, but its full length nature has not been determined.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
50,471 Da
NCBI Official Full Name
retinoic acid receptor beta
NCBI Official Synonym Full Names
retinoic acid receptor beta
NCBI Official Symbol
RARB
NCBI Official Synonym Symbols
RARBETA
NCBI Protein Information
retinoic acid receptor beta
UniProt Protein Name
Retinoic acid receptor beta
Protein Family
UniProt Gene Name
RARB
UniProt Synonym Gene Names
NR1B2; RAR-beta
Uniprot Description
Receptor for retinoic acid. Retinoic acid receptors bind as heterodimers to their target response elements in response to their ligands, all-trans or 9-cis retinoic acid, and regulate gene expression in various biological processes. The RAR/RXR heterodimers bind to the retinoic acid response elements (RARE) composed of tandem 5'-AGGTCA-3' sites known as DR1-DR5 (). Required for limb and craniofacial development.
Research Articles on RARB
Similar Products
Product Notes
The RARB rarb (Catalog #AAA963366) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-455, Full length protein. The amino acid sequence is listed below: MTTSSRTCPV PAVNGHMTHY PAAPYPLLFP PVIGGLSLPS LHGLQSHPPT SGCSTPSPAT VETQSTSSEE LVPSPPSPLP PPRVYKPCFV CQDKSSGYHY GVSACEGCKG FFRRSIQKNM VYTCHRDKNC VINKVTRNRC QYCRLQKCFE VGMSKESVRN DRNKKKKEPT KQESTENYEM TAELDDLTEK IRKAHQETFP SLCQLGKYTT NSSADHRVRL DLGLWDKFSE LATKCIIKIV EFAKRLPGFT SLTIADQITL LKAACLDILI LRICTRYTPE QDTMTFSDGL TLNRTQMHNA GFGPLTDLVF TFANQLLPLE MDDTETGLLS AICLICGDRQ DLEEPMKVDK LQEPLLEALK IYIRKRRPNK PHMFPKILMK ITDLRSISAK GAERVITLKM EIPGSMPPLI QEMLENSEGH EPLTPTSNGN TAEHSPSISP SSVDNSSVSQ SPMVQ. It is sometimes possible for the material contained within the vial of "Retinoic acid receptor beta (RARB), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
