Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-FOXN4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysate)

Rabbit FOXN4 Polyclonal Antibody | anti-FOXN4 antibody

FOXN4 antibody - C-terminal region

Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FOXN4; Polyclonal Antibody; FOXN4 antibody - C-terminal region; anti-FOXN4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HHQVQPQAHLAPDSPAPAQTPPLHALPDLSPSPLPHPAMGRAPVDFINIS
Sequence Length
517
Applicable Applications for anti-FOXN4 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 93%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human FOXN4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-FOXN4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysate)

Western Blot (WB) (WB Suggested Anti-FOXN4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysate)
Related Product Information for anti-FOXN4 antibody
This is a rabbit polyclonal antibody against FOXN4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Members of the winged-helix/forkhead family of transcription factors, such as FOXN4, are characterized by a 110-amino acid DNA-binding domain that can fold into a variant of the helix-turn-helix motif consisting of 3 alpha helices flanked by 2 large loops or wings. These transcription factors are involved in a variety of biologic processes as key regulators in development and metabolism.Members of the winged-helix/forkhead family of transcription factors, such as FOXN4, are characterized by a 110-amino acid DNA-binding domain that can fold into a variant of the helix-turn-helix motif consisting of 3 alpha helices flanked by 2 large loops or wings. These transcription factors are involved in a variety of biologic processes as key regulators in development and metabolism (Li et al., 2004 [PubMed 15363391]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-178 BC146825.1 2-179 179-191 AK131519.1 179-191 192-500 BC146825.1 193-501 501-1569 AF425596.1 276-1344 1570-3350 BC146825.1 1571-3351 3351-3356 AA421288.1 1-6 c

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
forkhead box protein N4
NCBI Official Synonym Full Names
forkhead box N4
NCBI Official Symbol
FOXN4
NCBI Protein Information
forkhead box protein N4
UniProt Protein Name
Forkhead box protein N4
Protein Family
UniProt Gene Name
FOXN4
UniProt Entry Name
FOXN4_HUMAN

NCBI Description

Members of the winged-helix/forkhead family of transcription factors, such as FOXN4, are characterized by a 110-amino acid DNA-binding domain that can fold into a variant of the helix-turn-helix motif consisting of 3 alpha helices flanked by 2 large loops or wings. These transcription factors are involved in a variety of biologic processes as key regulators in development and metabolism (Li et al., 2004 [PubMed 15363391]).[supplied by OMIM, Mar 2008]

Uniprot Description

FOXN4: 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; Cell development/differentiation; Transcription factor

Chromosomal Location of Human Ortholog: 12q24.11

Cellular Component: nucleus

Molecular Function: chromatin binding; transcription factor activity

Biological Process: transcription, DNA-dependent; regulation of transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; heart looping; regulation of heart contraction

Similar Products

Product Notes

The FOXN4 foxn4 (Catalog #AAA3208755) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FOXN4 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's FOXN4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FOXN4 foxn4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HHQVQPQAHL APDSPAPAQT PPLHALPDLS PSPLPHPAMG RAPVDFINIS. It is sometimes possible for the material contained within the vial of "FOXN4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.