Ras-related protein Rap-1b (RAP1B) Recombinant Protein | RAP1B recombinant protein

Recombinant Human Ras-related protein Rap-1b (RAP1B)

Cat. Num. AAA950449

• Gene Names: RAP1B; K-REV; RAL1B
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Ras-related protein Rap-1b (RAP1B); Recombinant Human Ras-related protein Rap-1b (RAP1B); RAP1B recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-181, Full length protein
• Sequence: MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSSC
• Sequence Length: 181

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 58219792
• NCBI GeneID: 5908
• NCBI Accession #: NP_001010942.1
• NCBI GenBank Nucleotide #: NM_001010942.2
• UniProt Accession #: P61224; P09526; Q502X3; Q5TZR4; Q6DCA1; Q6LES0; B2R5Z2; B4DQI8; B4DW74; B4DW94
• Molecular Weight: 16,033 Da
• NCBI Official Full Name: ras-related protein Rap-1b isoform 1
• NCBI Official Synonym Full Names: RAP1B, member of RAS oncogene family
• NCBI Official Symbol: RAP1B
• NCBI Official Synonym Symbols: K-REV; RAL1B
• NCBI Protein Information: ras-related protein Rap-1b
• UniProt Protein Name: Ras-related protein Rap-1b
• Protein Family: Ras-related protein
• UniProt Gene Name: RAP1B

NCBI Description

This gene encodes a member of the RAS-like small GTP-binding protein superfamily. Members of this family regulate multiple cellular processes including cell adhesion and growth and differentiation. This protein localizes to cellular membranes and has been shown to regulate integrin-mediated cell signaling. This protein also plays a role in regulating outside-in signaling in platelets. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 3, 5, 6 and 9. [provided by RefSeq, Oct 2011]

Uniprot Description

GTP-binding protein that possesses intrinsic GTPase activity. Contributes to the polarizing activity of KRIT1 and CDH5 in the establishment and maintenance of correct endothelial cell polarity and vascular lumen. Required for the localization of phosphorylated PRKCZ, PARD3 and TIAM1 to the cell junction. Plays a role in the establishment of basal endothelial barrier function.