E3 ubiquitin-protein ligase RAD18 (Rad18) Recombinant Protein | Rad18 recombinant protein
Recombinant Mouse E3 ubiquitin-protein ligase RAD18 (Rad18)
Gene Names
Rad18; Rad18sc; 2810024C04Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
E3 ubiquitin-protein ligase RAD18 (Rad18); Recombinant Mouse E3 ubiquitin-protein ligase RAD18 (Rad18); Rad18 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-509, Full length protein
Sequence
MEVLAEPRWPPGLAVMKTIDDLLRCGICFEYFNIAVIIPQCSHNYCSLCIRKFLSYKTQCPTCCVAVTEPDLRNNRLLDELVKSMNFARTHLLQFALESPPISPVSSTSKKVVVKVHNADAAQHPVKQANRLMDKFLIRETGDCVFELLGKENERKFSPQKELSTSAEIKETSLLGKPVLGLSDANGPVTPSTSTMKLDTKVSCPVCGVSIPENHINKHLDSCLSREEKKESLRSSAHKRKPLPKTVYNLLSDRDLKKKLKQYGLSVQGNKQQLIKRHQEFVHMYNAQCDALHPKSAAEIVQEIESMEKTRMRLEASKLNENVMVFTKNQTEKEIEEVHSEYRKKHQNAFQLLVDQAKKGYKKTGRVSQAAAMRTDEPAETLPSMRTDEPAETLPSMRTDEPAETLPLMRADEPAETLPSECIAQEDNVSFSDTVSVTNHFPQPQLDSPGPSEPERPDDSSSCTDILFSSDSDSCNRNDQNREVSPQQTRRTRASECVEIEPRNKRNKN
Sequence Length
509
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Rad18 recombinant protein
This protein is highly similar to S. cerevisiae DNA damage repair protein Rad18. Yeast Rad18 functions through its interaction with Rad6, which is an ubiquitin-conjugating enzyme required for post-replication repair of damaged DNA. Similar to its yeast counterpart, this protein is able to interact with the human homolog of yeast Rad6 protein through a conserved ring-finger motif. Mutation of this motif results in defective replication of UV-damaged DNA and hypersensitivity to multiple mutagens.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
57,412 Da
NCBI Official Full Name
E3 ubiquitin-protein ligase RAD18 isoform 2
NCBI Official Synonym Full Names
RAD18 E3 ubiquitin protein ligase
NCBI Official Symbol
Rad18
NCBI Official Synonym Symbols
Rad18sc; 2810024C04Rik
NCBI Protein Information
E3 ubiquitin-protein ligase RAD18
UniProt Protein Name
E3 ubiquitin-protein ligase RAD18
Protein Family
UniProt Gene Name
Rad18
UniProt Synonym Gene Names
Rad18sc; mRAD18Sc
Uniprot Description
E3 ubiquitin-protein ligase involved in postreplication repair of UV-damaged DNA. Postreplication repair functions in gap-filling of a daughter strand on replication of damaged DNA. Associates to the E2 ubiquitin conjugating enzyme UBE2B to form the UBE2B-RAD18 ubiquitin ligase complex involved in mono-ubiquitination of DNA-associated PCNA on 'Lys-164'. Has ssDNA binding activity.
Research Articles on Rad18
Similar Products
Product Notes
The Rad18 rad18 (Catalog #AAA1386360) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-509, Full length protein. The amino acid sequence is listed below: MEVLAEPRWP PGLAVMKTID DLLRCGICFE YFNIAVIIPQ CSHNYCSLCI RKFLSYKTQC PTCCVAVTEP DLRNNRLLDE LVKSMNFART HLLQFALESP PISPVSSTSK KVVVKVHNAD AAQHPVKQAN RLMDKFLIRE TGDCVFELLG KENERKFSPQ KELSTSAEIK ETSLLGKPVL GLSDANGPVT PSTSTMKLDT KVSCPVCGVS IPENHINKHL DSCLSREEKK ESLRSSAHKR KPLPKTVYNL LSDRDLKKKL KQYGLSVQGN KQQLIKRHQE FVHMYNAQCD ALHPKSAAEI VQEIESMEKT RMRLEASKLN ENVMVFTKNQ TEKEIEEVHS EYRKKHQNAF QLLVDQAKKG YKKTGRVSQA AAMRTDEPAE TLPSMRTDEP AETLPSMRTD EPAETLPLMR ADEPAETLPS ECIAQEDNVS FSDTVSVTNH FPQPQLDSPG PSEPERPDDS SSCTDILFSS DSDSCNRNDQ NREVSPQQTR RTRASECVEI EPRNKRNKN. It is sometimes possible for the material contained within the vial of "E3 ubiquitin-protein ligase RAD18 (Rad18), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
