Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western blot (Western blot analysis TNFSF4 using COS7 whole cell lysates)

Rabbit anti-Human TNFSF4 Antibody | anti-TNFSF4 antibody

TNFSF4 Antibody

Gene Names
TNFSF4; GP34; CD252; OX4OL; TXGP1; CD134L; OX-40L; TNLG2B
Reactivity
Human
Applications
Western Blot, Immunohistochemistry
Purity
Immunogen affinity purified
Synonyms
TNFSF4; TNFSF4 Antibody; anti-TNFSF4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Isotype
IgG
Specificity
TNFSF4 Antibody detects endogenous levels of total TNFSF4
Purity/Purification
Immunogen affinity purified
Form/Format
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Sequence
MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQ SIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQ KDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEF CVL
Sequence Length
133
Applicable Applications for anti-TNFSF4 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
WB 1:500-1:2000
IHC 1:50-1:200
Optimal dilutions/concentrations should be determined by the end user.
Immunogen
A synthesized peptide derived from human TNFSF4
Function
Cytokine that binds to TNFRSF4. Co-stimulates T-cell proliferation and cytokine production.
Subcellular Location
Membrane,Single-pass type II membrane protein
Subunit Structure
Homotrimer
Similarity
Belongs to the tumor necrosis factor family
Preparation and Storage
Store at -20°C. Stable for 12 months from date of receipt

Western blot

(Western blot analysis TNFSF4 using COS7 whole cell lysates)

Western blot (Western blot analysis TNFSF4 using COS7 whole cell lysates)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21kDa
NCBI Official Full Name
tumor necrosis factor ligand superfamily member 4 isoform 2
NCBI Official Synonym Full Names
tumor necrosis factor superfamily member 4
NCBI Official Symbol
TNFSF4
NCBI Official Synonym Symbols
GP34; CD252; OX4OL; TXGP1; CD134L; OX-40L; TNLG2B
NCBI Protein Information
tumor necrosis factor ligand superfamily member 4
UniProt Protein Name
Tumor necrosis factor ligand superfamily member 4
UniProt Gene Name
TNFSF4
UniProt Synonym Gene Names
TXGP1; OX40L

NCBI Description

This gene encodes a cytokine of the tumor necrosis factor (TNF) ligand family. The encoded protein functions in T cell antigen-presenting cell (APC) interactions and mediates adhesion of activated T cells to endothelial cells. Polymorphisms in this gene have been associated with Sjogren's syndrome and systemic lupus erythematosus. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]

Uniprot Description

TNFSF4: Cytokine that binds to TNFRSF4. Co-stimulates T-cell proliferation and cytokine production. Genetic variations in TNFSF4 influence susceptibility to systemic lupus erythematosus (SLE). SLE is a chronic, inflammatory and often febrile multisystemic disorder of connective tissue. It affects principally the skin, joints, kidneys and serosal membranes. It is thought to represent a failure of the regulatory mechanisms of the autoimmune system. The upstream region of TNFSF4 contains a single risk haplotype for SLE, which is correlated with increased expression of both cell-surface TNFSF4 and TNFSF4 transcripts. Increased levels of TNFSF4 are thought to augment T-cell-APC interaction and the functional consequences of T-cell activation, thereby destabilizing peripheral tolerance. Belongs to the tumor necrosis factor family.

Protein type: Cell cycle regulation; Cytokine; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1q25.1

Cellular Component: cell surface; extracellular space; plasma membrane

Molecular Function: receptor binding; tumor necrosis factor receptor superfamily binding

Biological Process: acute inflammatory response; defense response to nematode; negative regulation of interferon-gamma production; negative regulation of interleukin-17 production; negative regulation of regulatory T cell differentiation; negative regulation of T-helper 1 cell differentiation; negative regulation of transcription factor activity; negative regulation of transcription, DNA-dependent; positive regulation of alpha-beta T cell proliferation; positive regulation of B cell activation; positive regulation of CD4-positive, alpha beta T cell differentiation; positive regulation of cell proliferation; positive regulation of immunoglobulin mediated immune response; positive regulation of immunoglobulin secretion; positive regulation of inflammatory response; positive regulation of interferon-gamma production; positive regulation of interleukin-10 production; positive regulation of interleukin-12 production; positive regulation of interleukin-13 production; positive regulation of interleukin-4 production; positive regulation of interleukin-6 production; positive regulation of memory T cell differentiation; positive regulation of T cell cytokine production; positive regulation of T cell proliferation; positive regulation of T-helper 2 cell differentiation; positive regulation of T-helper 2 type immune response; regulation of adaptive immune response; regulation of inflammatory response; response to virus; signal transduction; tumor necrosis factor-mediated signaling pathway

Disease: Myocardial Infarction, Susceptibility To

Research Articles on TNFSF4

Similar Products

Product Notes

The TNFSF4 tnfsf4 (Catalog #AAA9387908) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TNFSF4 Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TNFSF4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). WB 1:500-1:2000 IHC 1:50-1:200 Optimal dilutions/concentrations should be determined by the end user. Researchers should empirically determine the suitability of the TNFSF4 tnfsf4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MERVQPLEEN VGNAARPRFE RNKLLLVASV IQGLGLLLCF TYICLHFSAL QVSHRYPRIQ SIKVQFTEYK KEKGFILTSQ KEDEIMKVQN NSVIINCDGF YLISLKGYFS QEVNISLHYQ KDEEPLFQLK KVRSVNSLMV ASLTYKDKVY LNVTTDNTSL DDFHVNGGEL ILIHQNPGEF CVL. It is sometimes possible for the material contained within the vial of "TNFSF4, Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.