Ras-related protein Rab-5A Recombinant Protein | RAB5A recombinant protein

Recombinant Human Ras-related protein Rab-5A

Cat. Num. AAA964811

• Gene Names: RAB5A; RAB5
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Ras-related protein Rab-5A; Recombinant Human Ras-related protein Rab-5A; RAB5A recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-215aa; Full Length
• Sequence: MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN
• Sequence Length: 201

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for RAB5A recombinant protein

The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different sets of downstream effectors directly responsible for vesicle formation, movent, tethering and fusion. RAB5A is required for the fusion of plasma membranes and early endosomes. Contributes to the regulation of filopodia extension.

Product Categories/Family for RAB5A recombinant protein

Developmental Biology

References

The human Rab genes encode a family of GTP-binding proteins related to yeast YPT1 and SEC4 products involved in secretion.Zahraoui A., Touchot N., Chardin P., Tavitian A.J. Biol. Chem. 264:12394-12401(1989) Rab geranylgeranyl transferase catalyzes the geranylgeranylation of adjacent cysteines in the small GTPases Rab1A, Rab3A, and Rab5A.Farnsworth C.C., Seabra M.C., Ericsson L.H., Gelb M.H., Glomset J.A.Proc. Natl. Acad. Sci. U.S.A. 91:11963-11967(1994) Identification of a new oncogene in human cancers.Kim J.W.cDNA clones of human proteins involved in signal transduction sequenced by the Guthrie cDNA resource center (www.cdna.org) .Puhl H.L. III, Ikeda S.R., Aronstam R.S. Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C. Direct interaction of EEA1 with Rab5b.Callaghan J.M., Nixon S., Bucci C., Toh B.-H., Stenmark H.Eur. J. Biochem. 265:361-366(1999) A novel membrane-anchored Rab5 interacting protein required for homotypic endosome fusion.Hoffenberg S., Liu X., Nikolova L., Hall H.S., Dai W., Baughn R.E., Dickey B.F., Barbieri M.A., Aballay A., Stahl P.D., Knoll B.J.J. Biol. Chem. 275:24661-24669(2000) Rabenosyn-5, a novel Rab5 effector, is complexed with hVPS45 and recruited to endosomes through a FYVE finger domain.Nielsen E., Christoforidis S., Uttenweiler-Joseph S., Miaczynska M., Dewitte F., Wilm M., Hoflack B., Zerial M.J. Cell Biol. 151:601-612(2000) Ras-activated endocytosis is mediated by the Rab5 guanine nucleotide exchange activity of RIN1.Tall G.G., Barbieri M.A., Stahl P.D., Horazdovsky B.F.Dev. Cell 1:73-82(2001) ALS2CL, the novel protein highly homologous to the carboxy-terminal half of ALS2, binds to Rab5 and modulates endosome dynamics.Hadano S., Otomo A., Suzuki-Utsunomiya K., Kunita R., Yanagisawa Y., Showguchi-Miyata J., Mizumura H., Ikeda J.-E.FEBS Lett. 575:64-70(2004) Rabip4' is an effector of rab5 and rab4 and regulates transport through early endosomes.Fouraux M.A., Deneka M., Ivan V., van der Heijden A., Raymackers J., van Suylekom D., van Venrooij W.J., van der Sluijs P., Pruijn G.J.M.Mol. Biol. Cell 15:611-624(2004) Regulation of dendritic branching and filopodia formation in hippocampal neurons by specific acylated protein motifs.Gauthier-Campbell C., Bredt D.S., Murphy T.H., El-Husseini A.Mol. Biol. Cell 15:2205-2217(2004) Structural basis of family-wide Rab GTPase recognition by rabenosyn-5.Eathiraj S., Pan X., Ritacco C., Lambright D.G.Nature 436:415-419(2005) Rab5-activating protein 6, a novel endosomal protein with a role in endocytosis.Hunker C.M., Galvis A., Kruk I., Giambini H., Veisaga M.L., Barbieri M.A.Biochem. Biophys. Res. Commun. 340:967-975(2006) Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes.Chi A., Valencia J.C., Hu Z.-Z., Watabe H., Yamaguchi H., Mangini N.J., Huang H., Canfield V.A., Cheng K.C., Yang F., Abe R., Yamagishi S., Shabanowitz J., Hearing V.J., Wu C., Appella E., Hunt D.F.J. Proteome Res. 5:3135-3144(2006) A quantitative atlas of mitotic phosphorylation.Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011) Rab1a and Rab5a preferentially bind to binary lipid compositions with higher stored curvature elastic energy.Kirsten M.L., Baron R.A., Seabra M.C., Ces O.Mol. Membr. Biol. 30:303-314(2013) High resolution crystal structures of human Rab5a and five mutants with substitutions in the catalytically important phosphate-binding loop.Zhu G., Liu J., Terzyan S., Zhai P., Li G., Zhang X.C.J. Biol. Chem. 278:2452-2460(2003) Refinement of the structure of human Rab5a GTPase domain at 1.05 A resolution.Terzyan S., Zhu G., Li G., Zhang X.C.Acta Crystallogr. D 60:54-60(2004) Structural basis of Rab5-Rabaptin5 interaction in endocytosis.Zhu G., Zhai P., Liu J., Terzyan S., Li G., Zhang X.C.Nat. Struct. Mol. Biol. 11:975-983(2004) Structural basis for Rab GTPase recognition and endosome tethering by the C2H2 zinc finger of early endosomal autoantigen 1 (EEA1) .Mishra A., Eathiraj S., Corvera S., Lambright D.G.Proc. Natl. Acad. Sci. U.S.A. 107:10866-10871(2010)

NCBI and Uniprot Product Information

• NCBI GI #: 635574573
• NCBI GeneID: 5868
• NCBI Accession #: NP_001278977.1
• NCBI GenBank Nucleotide #: NM_001292048.1
• UniProt Accession #: P20339; Q6FI44; B4DJA5
• Molecular Weight: 39.7 kDa
• NCBI Official Full Name: ras-related protein Rab-5A isoform 2
• NCBI Official Synonym Full Names: RAB5A, member RAS oncogene family
• NCBI Official Symbol: RAB5A
• NCBI Official Synonym Symbols: RAB5
• NCBI Protein Information: ras-related protein Rab-5A
• UniProt Protein Name: Ras-related protein Rab-5A
• Protein Family: Ras-related protein
• UniProt Gene Name: RAB5A
• UniProt Synonym Gene Names: RAB5
• UniProt Entry Name: RAB5A_HUMAN

Uniprot Description

RAB5A: Required for the fusion of plasma membranes and early endosomes. Contributes to the regulation of filopodia extension. Binds EEA1. Interacts with RIN1 and GAPVD1, which regulate its pathway, probably by acting as a GEF. Interacts with ALS2CL, RABEP1, SUN2, ZFYVE20 and RUFY1. Interacts with SGSM1 and SGSM3. Interacts with PIK3CB. Regulated by guanine nucleotide exchange factors (GEFs) which promote the exchange of bound GDP for free GTP. Belongs to the small GTPase superfamily. Rab family.

Protein type: G protein, monomeric, Rab; G protein, monomeric; G protein; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 3p24-p22

Cellular Component: actin cytoskeleton; axon; cell soma; cytoplasm; cytosol; dendrite; early endosome; endocytic vesicle; endosome; endosome membrane; lipid raft; melanosome; nerve terminal; phagocytic vesicle; plasma membrane; ruffle; synaptic vesicle; terminal button

Molecular Function: GDP binding; GTP binding; GTPase activity; protein binding

Biological Process: blood coagulation; early endosome to late endosome transport; endocytosis; positive regulation of exocytosis; protein transport; regulation of endocytosis; regulation of endosome size; regulation of filopodium formation; small GTPase mediated signal transduction