Putative major capsid protein Recombinant Protein | EFP_gp016 recombinant protein
Recombinant Enterococcus phage phiEF24C Putative major capsid protein
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Putative major capsid protein; Recombinant Enterococcus phage phiEF24C Putative major capsid protein; Recombinant Putative major capsid protein; EFP_gp016 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
21-464
Sequence
GFTTGYGITPESQTDAAALRREFLDDQITMLTWADGDLSFYRDITKRPATSTVAKYDVYLAHGRVGHTRFTREIGVAPISDPNLRQKTVNMKYVSDTKNMSIATGLVNNIEDPMRILTDDAISVVAKTIEWASFYGDSDLSENPDAGSGLEFDGLAKLIDKHNVLDAKGASLTEALLNQASVLVGKGYGTPTDAYMPIGVQADFVNQQLDRQVQVISDNGQNATMGFNVKGFNSARGFIRLHGSTVMELEQILDENRMQLPNAPQKATVKATLEAGTKGKFRDEDLTIDTEYKVVVVSDDAESAPSDVASVVIDDKKKQVKLEITINNMYQARPQYVAIYRKGLETGLFYQIARVPASKAVEGVITFIDVNDEIPETADVFVGELTPSVVHLFELLPMMRLPLAQVNASVTFAVLWYGALALRAPKKWARIKNVKYIATGNVFN
Sequence Length
464
Species
Enterococcus phage phiEF24C (Enterococcus bacteriophage phi-EF24C)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
51,177 Da
NCBI Official Full Name
putative major capsid protein
NCBI Official Symbol
EFP_gp016
NCBI Protein Information
putative major capsid protein
UniProt Protein Name
Putative major capsid protein
Protein Family
UniProt Entry Name
VPN2_BPPHE
Uniprot Description
Subcellular location: Virion
Potential. Host membrane; Single-pass membrane protein
Potential Ref.2.
Similar Products
Product Notes
The EFP_gp016 (Catalog #AAA1188329) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 21-464. The amino acid sequence is listed below: GFTTGYGITP ESQTDAAALR REFLDDQITM LTWADGDLSF YRDITKRPAT STVAKYDVYL AHGRVGHTRF TREIGVAPIS DPNLRQKTVN MKYVSDTKNM SIATGLVNNI EDPMRILTDD AISVVAKTIE WASFYGDSDL SENPDAGSGL EFDGLAKLID KHNVLDAKGA SLTEALLNQA SVLVGKGYGT PTDAYMPIGV QADFVNQQLD RQVQVISDNG QNATMGFNVK GFNSARGFIR LHGSTVMELE QILDENRMQL PNAPQKATVK ATLEAGTKGK FRDEDLTIDT EYKVVVVSDD AESAPSDVAS VVIDDKKKQV KLEITINNMY QARPQYVAIY RKGLETGLFY QIARVPASKA VEGVITFIDV NDEIPETADV FVGELTPSVV HLFELLPMMR LPLAQVNASV TFAVLWYGAL ALRAPKKWAR IKNVKYIATG NVFN. It is sometimes possible for the material contained within the vial of "Putative major capsid protein, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
