Light-harvesting protein B-870 alpha chain (pufA) Recombinant Protein | pufA recombinant protein
Recombinant Roseobacter denitrificans Light-harvesting protein B-870 alpha chain (pufA)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Light-harvesting protein B-870 alpha chain (pufA); Recombinant Roseobacter denitrificans Light-harvesting protein B-870 alpha chain (pufA); Recombinant Light-harvesting protein B-870 alpha chain (pufA); Light-harvesting protein B-870 alpha chain; Antenna pigment protein alpha chain; pufA recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-52
Sequence
MAKFYKIWLIFDPRRVFVAQGVFLFLLAAMIHLVVLSSGLNWFEAAAAVGGQ
Sequence Length
52
Species
Roseobacter denitrificans (strain ATCC 33942 / OCh 114) (Erythrobacter sp. (strain OCh 114)) (Roseobacter denitrificans)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
5,814 Da
NCBI Official Full Name
light-harvesting protein B-875, alpha chain
NCBI Official Symbol
pufA
NCBI Protein Information
light-harvesting protein B-875, alpha chain
UniProt Protein Name
Light-harvesting protein B-870 alpha chain
Protein Family
UniProt Gene Name
pufA
UniProt Entry Name
LHA_ROSDO
Uniprot Description
Function: Antenna complexes are light-harvesting systems, which transfer the excitation energy to the reaction centers.
Subunit structure: The core complex is formed by different alpha and beta chains, binding bacteriochlorophyll molecules, and arranged most probably in tetrameric structures disposed around the reaction center. The non-pigmented gamma chains may constitute additional components.
Subcellular location: Cell inner membrane; Single-pass type II membrane protein.
Sequence similarities: Belongs to the antena complex alpha subunit family.
Similar Products
Product Notes
The pufA pufa (Catalog #AAA1085472) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-52. The amino acid sequence is listed below: MAKFYKIWLI FDPRRVFVAQ GVFLFLLAAM IHLVVLSSGL NWFEAAAAVG GQ. It is sometimes possible for the material contained within the vial of "Light-harvesting protein B-870 alpha chain (pufA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
