SDS-PAGE
Prothoracicotropic hormone Recombinant Protein | PTTH recombinant protein
Recombinant Bombyx mori (Silk moth) Prothoracicotropic hormone
Gene Names
PTTH; PTTH-KS
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Prothoracicotropic hormone; Recombinant Bombyx mori (Silk moth) Prothoracicotropic hormone; PTTH recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
116-224aa; Full Length
Sequence
GNIQVENQAIPDPPCTCKYKKEIEDLGENSVPRFIETRNCNKTQQPTCRPPYICKESLYSITILKRRETKSQESLEIPNELKYRWVAESHPVSVACLCTRDYQLRYNNN
Sequence Length
224
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for PTTH recombinant protein
PTTH is a brain secretory polypeptide of insects which stimulates the prothoracic glands to produce and release ecdysone, the steroid essential to insect development. Peptides P2K and P6K are presumed to be cleaved post-translationally and may play some unknown physiologically or developmentally important functions.
References
Molecular cloning of the Bombyx mori prothoracicotropic hormone.Kawakami A., Kataoka H., Oka T., Mizoguchi A., Kimura-Kawakami M., Adachi T., Iwami M., Nagasawa H., Suzuki A., Ishizaki H.Science 247:1333-1335(1990)
Structure and expression of the gene for the prothoracicotropic hormone of the silkmoth Bombyx mori.Adachi-Yamada T., Iwami M., Kataoka H., Suzuki A., Ishizaki H.Eur. J. Biochem. 220:633-643(1994)
Prothoracicotropic hormone of the silkworm, Bombyx mori
amino acid sequence and dimeric structure.Kataoka H., Nagasawa H., Isogai A., Ishizaki H., Suzuki A.Agric. Biol. Chem. 55:73-86(1991)
Assignment of disulfide bond location in prothoracicotropic hormone of the silkworm, Bombyx mori
a homodimeric peptide.Ishibashi J., Kataoka H., Isogai A., Kawakami A., Saegusa H., Yagi Y., Mizoguchi A., Ishizaki H., Suzuki A.Biochemistry 33:5912-5919(1994)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16.7 kDa
NCBI Official Full Name
prothoracicotropic hormone preproprotein
NCBI Official Symbol
PTTH
NCBI Official Synonym Symbols
PTTH-KS
NCBI Protein Information
prothoracicotropic hormone
UniProt Protein Name
Prothoracicotropic hormone
Protein Family
UniProt Gene Name
PTTH
UniProt Synonym Gene Names
PTTH
UniProt Entry Name
PTTH_BOMMO
Uniprot Description
PTTH is a brain secretory polypeptide of insects which stimulates the prothoracic glands to produce and release ecdysone, the steroid essential to insect development.
Research Articles on PTTH
Similar Products
Product Notes
The PTTH ptth (Catalog #AAA1009579) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 116-224aa; Full Length. The amino acid sequence is listed below: GNIQVENQAI PDPPCTCKYK KEIEDLGENS VPRFIETRNC NKTQQPTCRP PYICKESLYS ITILKRRETK SQESLEIPNE LKYRWVAESH PVSVACLCTR DYQLRYNNN. It is sometimes possible for the material contained within the vial of "Prothoracicotropic hormone, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
