Prostaglandin reductase 2 (Ptgr2) Recombinant Protein | Ptgr2 recombinant protein
Recombinant Mouse Prostaglandin reductase 2 (Ptgr2)
Gene Names
Ptgr2; PGR-2; PRG-2; Zadh1; AI838763; 1810016I24Rik; 9130222H03Rik; 9630002F03Rik; B830026H24Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Prostaglandin reductase 2 (Ptgr2); Recombinant Mouse Prostaglandin reductase 2 (Ptgr2); Ptgr2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-351, full length protein
Sequence
MIIQRVVLNSRPGKNGNPVAENFRVEEFSLPDALNEGQVQVRTLYLSVDPYMRCKMNEDTGTDYLAPWQLAQVADGGGIGVVEESKHQKLTKGDFVTSFYWPWQTKAILDGNGLEKVDPQLVDGHLSYFLGAIGMPGLTSLIGVQEKGHISAGSNQTMVVSGAAGACGSLAGQIGHLLGCSRVVGICGTQEKCLFLTSELGFDAAVNYKTGNVAEQLREACPGGVDVYFDNVGGDISNAVISQMNENSHIILCGQISQYSNDVPYPPPLPPAVEAIRKERNITRERFTVLNYKDKFEPGILQLSQWFKEGKLKVKETMAKGLENMGVAFQSMMTGGNVGKQIVCISEDSSL
Sequence Length
351
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Ptgr2 recombinant protein
This gene encodes an enzyme involved in the metabolism of prostaglandins. The encoded protein catalyzes the NADPH-dependent conversion of 15-keto-prostaglandin E2 to 15-keto-13,14-dihydro-prostaglandin E2. This protein may also be involved in regulating activation of the peroxisome proliferator-activated receptor. Alternative splicing results in multiple transcript variants.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
34,449 Da
NCBI Official Full Name
prostaglandin reductase 2 isoform 1
NCBI Official Synonym Full Names
prostaglandin reductase 2
NCBI Official Symbol
Ptgr2
NCBI Official Synonym Symbols
PGR-2; PRG-2; Zadh1; AI838763; 1810016I24Rik; 9130222H03Rik; 9630002F03Rik; B830026H24Rik
NCBI Protein Information
prostaglandin reductase 2
UniProt Protein Name
Prostaglandin reductase 2
Protein Family
UniProt Gene Name
Ptgr2
UniProt Synonym Gene Names
Zadh1; PRG-2
Uniprot Description
Functions as 15-oxo-prostaglandin 13-reductase and acts on 15-keto-PGE1, 15-keto-PGE2, 15-keto-PGE1-alpha and 15-keto-PGE2-alpha with highest activity towards 15-keto-PGE2. Overexpression represses transcriptional activity of PPARG and inhibits adipocyte differentiation.
Research Articles on Ptgr2
Similar Products
Product Notes
The Ptgr2 ptgr2 (Catalog #AAA1335434) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-351, full length protein. The amino acid sequence is listed below: MIIQRVVLNS RPGKNGNPVA ENFRVEEFSL PDALNEGQVQ VRTLYLSVDP YMRCKMNEDT GTDYLAPWQL AQVADGGGIG VVEESKHQKL TKGDFVTSFY WPWQTKAILD GNGLEKVDPQ LVDGHLSYFL GAIGMPGLTS LIGVQEKGHI SAGSNQTMVV SGAAGACGSL AGQIGHLLGC SRVVGICGTQ EKCLFLTSEL GFDAAVNYKT GNVAEQLREA CPGGVDVYFD NVGGDISNAV ISQMNENSHI ILCGQISQYS NDVPYPPPLP PAVEAIRKER NITRERFTVL NYKDKFEPGI LQLSQWFKEG KLKVKETMAK GLENMGVAFQ SMMTGGNVGK QIVCISEDSS L. It is sometimes possible for the material contained within the vial of "Prostaglandin reductase 2 (Ptgr2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
