Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN (pteN) Recombinant Protein | pteN recombinant protein
Recombinant Dictyostelium discoideum Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN (pteN), partial
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Phosphatidylinositol 3; 4; 5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN (pteN); Recombinant Dictyostelium discoideum Phosphatidylinositol 3; partial; pteN recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-220aa; Partial
Sequence
MSNLLRVAVSKQKRRYQKNGYDLDLAYITDNIVAMGFPSEKVEGVFRNPMKDVQRFLDQYHKDHFKVYNLCSERVYDHSKFYGRVGYYPFDDHNAPQFEMIDAFCRDVDAWMKEDSKNIAVIHCKAGKGRTGLMICCWLMYCGMWKNTEDSLRFYAALRTYNQKGVTIPSQIRYVGYFGRSIRESIKYVPRNVTLKKIVLRPLPKEINLSEVQFNISVGK
Species
Dictyostelium discoideum (Slime mold)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
59,831 Da
NCBI Official Full Name
protein tyrosine phosphatase
NCBI Official Symbol
pten
NCBI Protein Information
3-phosphatidylinositol 3-phosphatase; protein tyrosine phosphatase
UniProt Protein Name
Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN
Protein Family
UniProt Gene Name
pteN
UniProt Synonym Gene Names
ptenA
Uniprot Description
Acts as a dual-specificity protein phosphatase, dephosphorylating tyrosine-, serine- and threonine-phosphorylated proteins. Also acts as a lipid phosphatase, removing the phosphate in the D3 position of the inositol ring from phosphatidylinositol 3,4,5-trisphosphate, phosphatidylinositol 3,4-diphosphate, phosphatidylinositol 3-phosphate and inositol 1,3,4,5-tetrakisphosphate (). Negative regulator of PI3K chemotaxis pathways. Overexpression leads to a suppression of a PI3K-dependent activation of pkbA, and these cells exhibit chemotaxis defects consistent with a reduction in PI3K activity.
Research Articles on pteN
Similar Products
Product Notes
The pteN pten (Catalog #AAA1315732) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-220aa; Partial. The amino acid sequence is listed below: MSNLLRVAVS KQKRRYQKNG YDLDLAYITD NIVAMGFPSE KVEGVFRNPM KDVQRFLDQY HKDHFKVYNL CSERVYDHSK FYGRVGYYPF DDHNAPQFEM IDAFCRDVDA WMKEDSKNIA VIHCKAGKGR TGLMICCWLM YCGMWKNTED SLRFYAALRT YNQKGVTIPS QIRYVGYFGR SIRESIKYVP RNVTLKKIVL RPLPKEINLS EVQFNISVGK . It is sometimes possible for the material contained within the vial of "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN (pteN), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
