Phosphatidylserine synthase 2 (PTDSS1) Recombinant Protein | PTDSS1 recombinant protein
Recombinant Chicken Phosphatidylserine synthase 2 (PTDSS1)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Phosphatidylserine synthase 2 (PTDSS1); Recombinant Chicken Phosphatidylserine synthase 2 (PTDSS1); Recombinant Phosphatidylserine synthase 2 (PTDSS1); Phosphatidylserine synthase 2; PSS-2; PtdSer synthase 2 EC= 2.7.8.29; Serine-exchange enzyme II; PTDSS1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-442
Sequence
MRRGERRGPAGPLGDGPALGLRRSTESEVYDDGTNTFFWRAHTLTVLFILTCALGYVTLLEETPQDTAYNTKRGIVASILVFLCFGVTQAKDGPFSRPHPAYWRFWLCVSVVYELFLIFILFQTVQDGRQFMKYIDPHLGVPLPERDYGGNCLIYDPGNESDPFHNIWDKLDGFVPAHFFGWYLKTLMIRDWWMCMIISVMFEFLEYSLEHQLPNFSECWWDHWIMDVILCNGLGIYCGMKTLSWLSLKTYKWQGLWNIPTYKGKMKRIVFQFTPYSWVKFEWKPASSLRRWLAVCGIIFVFLLAELNTFYLKFVLWMPPEHYLVLLRLVFFVNVGGVAMREIYDFMDDPKFHKKLGQQAWLVAAITATEFLIVVKYDPYTLTLSLPFYITQCWILGIILVLTWTAWRFFIRDITLRYKEIRRQKQEHKYEKDKCLSNGDGH
Sequence Length
442
Species
Gallus gallus (Chicken)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
UniProt Accession #
Molecular Weight
52,146 Da
UniProt Protein Name
Phosphatidylserine synthase 2
Protein Family
UniProt Gene Name
PTDSS1
UniProt Synonym Gene Names
PSS-2
UniProt Entry Name
PTSS2_CHICK
Uniprot Description
Function: Catalyzes a base-exchange reaction in which the polar head group of phosphatidylethanolamine (PE) or phosphatidylcholine (PC) is replaced by L-serine. PTDSS2 is specific for phosphatatidylethanolamine and does not act on phosphatidylcholine
By similarity.
Catalytic activity: L-1-phosphatidylethanolamine + L-serine = L-1-phosphatidylserine + ethanolamine.
Pathway: Phospholipid metabolism; phosphatidylserine biosynthesis.
Subcellular location: Endoplasmic reticulum membrane; Multi-pass membrane protein
By similarity. Note: Highly enriched in the mitochondria-associated membrane (MAM)
By similarity.
Sequence similarities: Belongs to the phosphatidyl serine synthase family.
Similar Products
Product Notes
The Phosphatidylserine synthase 2 (PTDSS1) ptdss1 (Catalog #AAA1115775) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-442. The amino acid sequence is listed below: MRRGERRGPA GPLGDGPALG LRRSTESEVY DDGTNTFFWR AHTLTVLFIL TCALGYVTLL EETPQDTAYN TKRGIVASIL VFLCFGVTQA KDGPFSRPHP AYWRFWLCVS VVYELFLIFI LFQTVQDGRQ FMKYIDPHLG VPLPERDYGG NCLIYDPGNE SDPFHNIWDK LDGFVPAHFF GWYLKTLMIR DWWMCMIISV MFEFLEYSLE HQLPNFSECW WDHWIMDVIL CNGLGIYCGM KTLSWLSLKT YKWQGLWNIP TYKGKMKRIV FQFTPYSWVK FEWKPASSLR RWLAVCGIIF VFLLAELNTF YLKFVLWMPP EHYLVLLRLV FFVNVGGVAM REIYDFMDDP KFHKKLGQQA WLVAAITATE FLIVVKYDPY TLTLSLPFYI TQCWILGIIL VLTWTAWRFF IRDITLRYKE IRRQKQEHKY EKDKCLSNGD GH. It is sometimes possible for the material contained within the vial of "Phosphatidylserine synthase 2 (PTDSS1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
