Proteasome inhibitor PI31 subunit (PSMF1) Recombinant Protein | PSMF1 recombinant protein
Recombinant Bovine Proteasome inhibitor PI31 subunit (PSMF1)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Proteasome inhibitor PI31 subunit (PSMF1); Recombinant Bovine Proteasome inhibitor PI31 subunit (PSMF1); PSMF1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-270. Full Length of Mature Protein
Sequence
AGLEVLFASAAPAITCAQDALVCFLHWEVVTHGYYGLGAGDQPGPNDKKSELLPVEWNSNKDLYVLRYESKDGSRKLLVKAVTVENSMIINVLEHGSQQVSDLTLNLNDYIDSEHLVDFHRVYKNSEELRSRIVSGIITPIHEQWEKANLSPHREFPPATAREVDPLRIHPQHPHTSRQPTWCDPLGPFAVGGEDLDPFGCRRGGMIVDPLRSGFPRALIDPSSGLPNRLPPGAVPPGARFDPFGPIGTSPSGPNPDHLPPPGYDDMYL
Species
Bovine
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for PSMF1 recombinant protein
The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP
ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a protein that inhibits the activation of the proteasome by the 11S and 19S regulators. Alternative transcript variants have been identified for this gene.
ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a protein that inhibits the activation of the proteasome by the 11S and 19S regulators. Alternative transcript variants have been identified for this gene.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
29,705 Da
NCBI Official Full Name
proteasome inhibitor PI31 subunit
NCBI Official Synonym Full Names
proteasome inhibitor subunit 1
NCBI Official Symbol
PSMF1
NCBI Protein Information
proteasome inhibitor PI31 subunit
UniProt Protein Name
Proteasome inhibitor PI31 subunit
Protein Family
UniProt Gene Name
PSMF1
Uniprot Description
Plays an important role in control of proteasome function. Inhibits the hydrolysis of protein and peptide substrates by the 20S proteasome. Also inhibits the activation of the proteasome by the proteasome regulatory proteins PA700 and PA28 ().
Similar Products
Product Notes
The PSMF1 psmf1 (Catalog #AAA1470516) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-270. Full Length of Mature Protein. The amino acid sequence is listed below: AGLEVLFASA APAITCAQDA LVCFLHWEVV THGYYGLGAG DQPGPNDKKS ELLPVEWNSN KDLYVLRYES KDGSRKLLVK AVTVENSMII NVLEHGSQQV SDLTLNLNDY IDSEHLVDFH RVYKNSEELR SRIVSGIITP IHEQWEKANL SPHREFPPAT AREVDPLRIH PQHPHTSRQP TWCDPLGPFA VGGEDLDPFG CRRGGMIVDP LRSGFPRALI DPSSGLPNRL PPGAVPPGAR FDPFGPIGTS PSGPNPDHLP PPGYDDMYL . It is sometimes possible for the material contained within the vial of "Proteasome inhibitor PI31 subunit (PSMF1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
