Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

26S proteasome non-ATPase regulatory subunit 5 (Psmd5) Recombinant Protein | Psmd5 recombinant protein

Recombinant Mouse 26S proteasome non-ATPase regulatory subunit 5 (Psmd5)

Gene Names
Psmd5; S5b; W91691; AW475925; mKIAA0072; 1500032A03Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
26S proteasome non-ATPase regulatory subunit 5 (Psmd5); Recombinant Mouse 26S proteasome non-ATPase regulatory subunit 5 (Psmd5); Psmd5 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-504, Full length protein
Sequence
AAQAVSLLREVARLEAPLEELRALQSVVQAVPLHELREQAAELRLRPLFSLLNQNNREQTALCVSILERLLQAVEPIHLARNLRLDLQRGLTHPDDSVKTLTLSQIGRIVENSEAVTEILNNAELLKQIVYCIGGENLSVAKAAIKSLSRISLTQAGLEALFESNLLDDLKNVMKTNDVVRYRVYELIIDISSVSSESLNYCTTSGLVTQLLKELTGEDVLVRATCIEMVTSLAYTHHGRQYLAQEGVIDQISNIIVGADSDPFSGFYLPGFVKFFGNLAVMDSPQQICERYPVFLEKVFEMADSQDPTMIGVAVDTVGILGSSVEGKQVLQKTGTRFERVLMRVGYQAKNASTELKIRCLDAVSSLLYLSPEQQTDDFLGMTESWFSSMSRDSLELFRGISNQPFPELHCAALKVFTAIADQPWAQRLMFNSPGFVEFVMDRSVEHDKASKDAKYELVKALANSKTVAEIFGNSNYLRLRAYLSEGPYYVKPVATTAVEGAD
Sequence Length
503
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Psmd5 recombinant protein
The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP
ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a non-ATPase subunit of the 19S regulator base.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55,972 Da
NCBI Official Full Name
26S proteasome non-ATPase regulatory subunit 5 isoform 1
NCBI Official Synonym Full Names
proteasome (prosome, macropain) 26S subunit, non-ATPase, 5
NCBI Official Symbol
Psmd5
NCBI Official Synonym Symbols
S5b; W91691; AW475925; mKIAA0072; 1500032A03Rik
NCBI Protein Information
26S proteasome non-ATPase regulatory subunit 5
UniProt Protein Name
26S proteasome non-ATPase regulatory subunit 5
UniProt Gene Name
Psmd5
UniProt Synonym Gene Names
Kiaa0072

Uniprot Description

Acts as a chaperone during the assembly of the 26S proteasome, specifically of the base subcomplex of the PA700/19S regulatory complex (RC). In the initial step of the base subcomplex assembly is part of an intermediate PSMD5:PSMC2:PSMC1:PSMD2 module which probably assembles with a PSMD10:PSMC4:PSMC5:PAAF1 module followed by dissociation of PSMD5 ().

Research Articles on Psmd5

Similar Products

Product Notes

The Psmd5 psmd5 (Catalog #AAA1323946) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-504, Full length protein. The amino acid sequence is listed below: AAQAVSLLRE VARLEAPLEE LRALQSVVQA VPLHELREQA AELRLRPLFS LLNQNNREQT ALCVSILERL LQAVEPIHLA RNLRLDLQRG LTHPDDSVKT LTLSQIGRIV ENSEAVTEIL NNAELLKQIV YCIGGENLSV AKAAIKSLSR ISLTQAGLEA LFESNLLDDL KNVMKTNDVV RYRVYELIID ISSVSSESLN YCTTSGLVTQ LLKELTGEDV LVRATCIEMV TSLAYTHHGR QYLAQEGVID QISNIIVGAD SDPFSGFYLP GFVKFFGNLA VMDSPQQICE RYPVFLEKVF EMADSQDPTM IGVAVDTVGI LGSSVEGKQV LQKTGTRFER VLMRVGYQAK NASTELKIRC LDAVSSLLYL SPEQQTDDFL GMTESWFSSM SRDSLELFRG ISNQPFPELH CAALKVFTAI ADQPWAQRLM FNSPGFVEFV MDRSVEHDKA SKDAKYELVK ALANSKTVAE IFGNSNYLRL RAYLSEGPYY VKPVATTAVE GAD. It is sometimes possible for the material contained within the vial of "26S proteasome non-ATPase regulatory subunit 5 (Psmd5), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.