Prox-1 (fragment) Recombinant Protein | Prox-1 recombinant protein

Human Prox-1 (fragment)

Cat. Num. AAA691976

• Reactivity: Human
• Purity: > 95% by SDS-PAGE & silver stain
• Synonyms: Prox-1 (fragment); Human Prox-1 (fragment); Recombinant Human Prox-1; Homeobox prospero-like protein 1; Prox-1 recombinant protein

• Host: E Coli
• Reactivity: Human
• Purity/Purification: > 95% by SDS-PAGE & silver stain
• Form/Format: Lyophilized
• Sequence: MAEGLSLSLIKSECGDLQDMSEISPYSGSAMQEGLSPNHLKKAKLMFFYT RYPSSNMLKTYFSDVKFNRCITSQLIKWFSNFREFYYIQMEKYARQAIND GVTSTEELSITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNA IIAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQELLHE
• Sequence Length: 192

• Buffer: PBS
• Preparation and Storage: The lyophilized protein is stable for a few weeks at room temperature, but best stored at -20 degree C. Reconstituted Prox-1 should be stored in working aliquots at -20 degree C. Avoid repeated freeze-thaw cycles.

Testing Data

Related Product Information for Prox-1 recombinant protein

Prox-1 is a homeobox gene and acts as a master switch for lymphatic endothelial phenotype. Expression of Prox-1 in blood endothelial cells induces expression of other lymphatic marker genes. Together with Podoplanin, Prox-1 can be used to reliably distinguish lympathic vessels from blood vessels. Prox1 is expressed in CNS, eye, pancreas, liver and heart, and it is one of the most specific and reliable markers for lymphatic endothelial cells. The highly conserved C-terminal part of the homeobox transcription factor Prox1 was produced in E. coli. It was not tested for activity and can be used as positive control e.g. in Western analysis.

Product Categories/Family for Prox-1 recombinant protein

Cytokines & Growth Factors

References

1. Belecky et al., Invest Ophthalmol Vis Sci 38, 1293 (1997) 2. Glasgow, Tomarev, Mech. Dev. 76, 175 (1998) 3. Rodriguez-Niedenfuhr et al., Anat Embryol 204, 399 (2001) 4. Wilting et al., FASEB J 16, 1271 (2002) 5. Krishnan et al., Cancer Res. 63, 713 (2003) 6. Mouta et al., Cancer Res. 61, 8079, (2001) 7.; Padera et al., Science 296, 1883 (2002)]

NCBI and Uniprot Product Information

• NCBI GI #: 397174762
• NCBI GeneID: 5629
• NCBI Accession #: NP_002754.2
• NCBI GenBank Nucleotide #: NM_002763.3
• UniProt Accession #: Q92786; Q5SW76; Q8TB91; A6NK29; A8K2B1
• Molecular Weight: 22.35 kDa
• NCBI Official Full Name: prospero homeobox protein 1
• NCBI Official Synonym Full Names: prospero homeobox 1
• NCBI Official Symbol: PROX1
• NCBI Protein Information: prospero homeobox protein 1; prospero-related homeobox 1; homeobox prospero-like protein PROX1
• UniProt Protein Name: Prospero homeobox protein 1
• UniProt Gene Name: PROX1
• UniProt Synonym Gene Names: PROX-1
• UniProt Entry Name: PROX1_HUMAN

NCBI Description

The protein encoded by this gene is a member of the homeobox transcription factor family. Members of this family contain a homeobox domain that consists of a 60-amino acid helix-turn-helix structure that binds DNA and RNA. The protein encoded by this gene is conserved across vertebrates and may play an essential role during development. Altered levels of this protein have been reported in cancers of different organs, such as colon, brain, blood, breast, pancreas, liver and esophagus. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2012]

Uniprot Description

Function: May play a fundamental role in early development of CNS. May regulate gene expression and development of postmitotic undifferentiated young neurons

By similarity.

Subcellular location: Nucleus

Probable.

Tissue specificity: Most actively expressed in the developing lens. Detected also in embryonic brain, lung, liver and kidney. In adult, it is more abundant in heart and liver than in brain, skeletal muscle, kidney and pancreas.

Sequence similarities: Belongs to the Prospero homeobox family.Contains 1 Prospero-type homeobox DNA-binding domain.

Sequence caution: The sequence CAI15309.1 differs from that shown. Reason: Erroneous gene model prediction.