Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Protein G Recombinant Protein

Recombinant Protein G

Purity
>96% as determined by SDS-PAGE and RP-HPLC.
Synonyms
Protein G; Recombinant Protein G; Protein G Recombinant; Protein-G; Protein G recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
>96% as determined by SDS-PAGE and RP-HPLC.
Form/Format
Lyophilized white powder containing no additives.
Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence
LPKTDTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDAT KTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTEAVDAATAEKVFK QYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTL KGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE.
Sequence Length
175
Solubility
Reconstitution with deionized water or PBS.
Reconstitution
Reconstitution with deionized water or PBS.
Preparation and Storage
Stability: Lyophilized Recombinant Protein G although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Protein G should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.
Related Product Information for Protein G recombinant protein
The Protein G is a single, non-glycosylated protein contains 200 amino acids having a molecular mass of 21.8kDa. The Protein-G migrates on SDS-PAGE around 32kDa.
Product Categories/Family for Protein G recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI Official Full Name
protein G
UniProt Protein Name
Protein G
Protein Family
UniProt Entry Name
C3V8X8_BPPHX

Uniprot Description

Attaches the circulating virion to the bacterial lipopolysaccharides which serve as receptor for the virus. Determines the phage host-range. Probably triggers with protein H the injection of the phage DNA into the host cytoplasm upon conformational changes induced by the interaction with host lipopolysaccharides.

Similar Products

Product Notes

The Protein G (Catalog #AAA142957) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: LPKTDT YKLILNGKTL KGETTTEAVD AATAEKVFKQ YANDNGVDGE WTYDDAT KTFTVTEKPE VIDASELTPA VTTYKLVING KTLKGETTTE AVDAATAEKV FK QYANDNGVDG EWTYDDATKT FTVTEKPEVI DASELTPAVT TYKLVINGKT L KGETTTKAVD AETAEKAFKQ YANDNGVDGV WTYDDATKTF TVTE.. It is sometimes possible for the material contained within the vial of "Protein G, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.