Probable cytochrome c oxidase subunit 5C-1 (At2g47380) Recombinant Protein | AT2G47380 recombinant protein
Recombinant Arabidopsis thaliana Probable cytochrome c oxidase subunit 5C-1 (At2g47380)
Gene Names
AT2G47380; T8I13.22
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable cytochrome c oxidase subunit 5C-1 (At2g47380); Recombinant Arabidopsis thaliana Probable cytochrome c oxidase subunit 5C-1 (At2g47380); Recombinant Probable cytochrome c oxidase subunit 5C-1 (At2g47380); Probable cytochrome c oxidase subunit 5C-1; Cytochrome c oxidase polypeptide Vc-1; AT2G47380 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-64
Sequence
MAGHKVAHATLKGPSVVKELFIGLALGLAAGGLWKMHHWNEQRKTRTFYDLLERGEISVVAAEE
Sequence Length
64
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
7,070 Da
NCBI Official Full Name
putative cytochrome c oxidase subunit 5C-1
NCBI Official Symbol
AT2G47380
NCBI Official Synonym Symbols
T8I13.22
NCBI Protein Information
putative cytochrome c oxidase subunit 5C-1
UniProt Protein Name
Probable cytochrome c oxidase subunit 5C-1
Protein Family
UniProt Entry Name
CX5C1_ARATH
Uniprot Description
Function: This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport
By similarity.
Subcellular location: Mitochondrion inner membrane
By similarity.
Sequence similarities: Belongs to the cytochrome c oxidase subunit 5C family.
Research Articles on AT2G47380
Similar Products
Product Notes
The AT2G47380 (Catalog #AAA1019614) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-64. The amino acid sequence is listed below: MAGHKVAHAT LKGPSVVKEL FIGLALGLAA GGLWKMHHWN EQRKTRTFYD LLERGEISVV AAEE. It is sometimes possible for the material contained within the vial of "Probable cytochrome c oxidase subunit 5C-1 (At2g47380), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
