Proline-specific permease (prnB) Recombinant Protein | AN1732.2 recombinant protein
Recombinant Emericella nidulans Proline-specific permease (prnB)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Proline-specific permease (prnB); Recombinant Emericella nidulans Proline-specific permease (prnB); Recombinant Proline-specific permease (prnB); Proline-specific permease; Proline transport protein; AN1732.2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-550
Sequence
MSPPSAKSMEEGRTPSVQYGYGDPKTLEGEIEEHTATKRGLSSRQLQLLAIGGCIGTGLFVGTSTVLTQTGPAPLLMSYIVMASIVWFVMNVLGEMTTYLPIRGVSVPYLIGRFTEPSIGFASGYNYWYSFAMLLASEVTASGLIIEYWNPPVSVGLWIAIVLVVILALNVFAVEWYGESEFWFAGLKILAIIGLIILGVVLFFGGGPNHDRLGFRYWQDPGAFNPYLVPGDTGKFLGFWTALIKSGFSFIFSPELITTAAGEVEAPRRNIPKATKRFIYRVFTFYILGSLVIGVTVAYNDPTLEAGVESGGSGAGASPFVVAIQNAGIGGLNHVVNAAILISAWSSGNAWCYAGSRTLYSLAGEGQAPKIFTRTNRTGVPYVAVLATWTIGLLSFLNLSSSGQTVFYWFTNITTVGGFINWVLIGIAYLRFRKALQFHGMLDMLPFKTPLQPYGTYYVMFIISILTLTNGYAVFFPGRFTASDFLVSYIVFAIFLALYAGHKIWYRTPWLTKVSEVDIFTGKDEIDRLCENDMERQPRNWLERVWWWIF
Sequence Length
552
Species
Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
60,810 Da
NCBI Official Full Name
PUTX_EMENI Proline-specific permease (Proline transport protein)
NCBI Official Symbol
AN1732.2
NCBI Protein Information
PUTX_EMENI Proline-specific permease (Proline transport protein)
UniProt Protein Name
Proline-specific permease
UniProt Gene Name
prnB
UniProt Entry Name
PUTX_EMENI
Uniprot Description
Function: Required for high-affinity proline transport.
Subcellular location: Membrane; Multi-pass membrane protein.
Induction: By L-proline.
Sequence similarities: Belongs to the amino acid-polyamine-organocation (APC) superfamily. YAT (TC 2.A.3.10) family. [View classification]
Sequence caution: The sequence CBF85456.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence EAA64018.1 differs from that shown. Reason: Erroneous gene model prediction.
Similar Products
Product Notes
The AN1732.2 prnb (Catalog #AAA1235948) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-550. The amino acid sequence is listed below: MSPPSAKSME EGRTPSVQYG YGDPKTLEGE IEEHTATKRG LSSRQLQLLA IGGCIGTGLF VGTSTVLTQT GPAPLLMSYI VMASIVWFVM NVLGEMTTYL PIRGVSVPYL IGRFTEPSIG FASGYNYWYS FAMLLASEVT ASGLIIEYWN PPVSVGLWIA IVLVVILALN VFAVEWYGES EFWFAGLKIL AIIGLIILGV VLFFGGGPNH DRLGFRYWQD PGAFNPYLVP GDTGKFLGFW TALIKSGFSF IFSPELITTA AGEVEAPRRN IPKATKRFIY RVFTFYILGS LVIGVTVAYN DPTLEAGVES GGSGAGASPF VVAIQNAGIG GLNHVVNAAI LISAWSSGNA WCYAGSRTLY SLAGEGQAPK IFTRTNRTGV PYVAVLATWT IGLLSFLNLS SSGQTVFYWF TNITTVGGFI NWVLIGIAYL RFRKALQFHG MLDMLPFKTP LQPYGTYYVM FIISILTLTN GYAVFFPGRF TASDFLVSYI VFAIFLALYA GHKIWYRTPW LTKVSEVDIF TGKDEIDRLC ENDMERQPRN WLERVWWWIF. It is sometimes possible for the material contained within the vial of "Proline-specific permease (prnB), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
