Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Prolactin-releasing peptide receptor (PRLHR) Recombinant Protein | PRLHR recombinant protein

Recombinant Human Prolactin-releasing peptide receptor (PRLHR)

Gene Names
PRLHR; GR3; GPR10; PrRPR
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Prolactin-releasing peptide receptor (PRLHR); Recombinant Human Prolactin-releasing peptide receptor (PRLHR); Recombinant Prolactin-releasing peptide receptor (PRLHR); Prolactin-releasing peptide receptor; PrRP receptor; PrRPR; G-protein coupled receptor 10 hGR3; PRLHR recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-370
Sequence
MASSTTRGPRVSDLFSGLPPAVTTPANQSAEASAGNGSVAGADAPAVTPFQSLQLVHQLKGLIVLLYSVVVVVGLVGNCLLVLVIARVRRLHNVTNFLIGNLALSDVLMCTACVPLTLAYAFEPRGWVFGGGLCHLVFFLQPVTVYVSVFTLTTIAVDRYVVLVHPLRRRISLRLSAYAVLAIWALSAVLALPAAVHTYHVELKPHDVRLCEEFWGSQERQRQLYAWGLLLVTYLLPLLVILLSYVRVSVKLRNRVVPGCVTQSQADWDRARRRRTFCLLVVIVVVFAVCWLPLHVFNLLRDLDPHAIDPYAFGLVQLLCHWLAMSSACYNPFIYAWLHDSFREELRKLLVAWPRKIAPHGQNMTVSVVI
Sequence Length
370
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41,121 Da
NCBI Official Full Name
prolactin-releasing peptide receptor
NCBI Official Synonym Full Names
prolactin releasing hormone receptor
NCBI Official Symbol
PRLHR
NCBI Official Synonym Symbols
GR3; GPR10; PrRPR
NCBI Protein Information
prolactin-releasing peptide receptor; hGR3; prRP receptor; G protein-coupled receptor 10; G-protein coupled receptor 10; prolactin releasing peptide receptor; prolactin-releasing hormone receptor
UniProt Protein Name
Prolactin-releasing peptide receptor
UniProt Gene Name
PRLHR
UniProt Synonym Gene Names
GPR10; GR3; PrRP receptor; PrRPR
UniProt Entry Name
PRLHR_HUMAN

NCBI Description

PRLHR is a 7-transmembrane domain receptor for prolactin-releasing hormone (PRLH; MIM 602663) that is highly expressed in anterior pituitary (Ozawa et al., 2002 [PubMed 11923475]).[supplied by OMIM, Mar 2008]

Uniprot Description

Function: Receptor for prolactin-releasing peptide (PrRP). Implicated in lactation, regulation of food intake and pain-signal processing.

Subunit structure: Interacts through its C-terminal region with the PDZ domain-containing proteins GRIP1, GRIP2 and PICK1. Interacts with PDZ domains 4 and 5 of GRIP1 and with the PDZ domain of PICK1. Ref.7

Subcellular location: Cell membrane; Multi-pass membrane protein.

Tissue specificity: Only detected in the pituitary gland and in all cell types of pituitary adenomas. Ref.3 Ref.6

Induction: Repressed by bromocriptine, a dopamine agonist. Ref.3

Sequence similarities: Belongs to the G-protein coupled receptor 1 family.

Sequence caution: The sequence AAC50504.1 differs from that shown. Reason: Frameshift at positions 168 and 175.

Research Articles on PRLHR

Similar Products

Product Notes

The PRLHR prlhr (Catalog #AAA718252) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-370. The amino acid sequence is listed below: MASSTTRGPR VSDLFSGLPP AVTTPANQSA EASAGNGSVA GADAPAVTPF QSLQLVHQLK GLIVLLYSVV VVVGLVGNCL LVLVIARVRR LHNVTNFLIG NLALSDVLMC TACVPLTLAY AFEPRGWVFG GGLCHLVFFL QPVTVYVSVF TLTTIAVDRY VVLVHPLRRR ISLRLSAYAV LAIWALSAVL ALPAAVHTYH VELKPHDVRL CEEFWGSQER QRQLYAWGLL LVTYLLPLLV ILLSYVRVSV KLRNRVVPGC VTQSQADWDR ARRRRTFCLL VVIVVVFAVC WLPLHVFNLL RDLDPHAIDP YAFGLVQLLC HWLAMSSACY NPFIYAWLHD SFREELRKLL VAWPRKIAPH GQNMTVSVVI. It is sometimes possible for the material contained within the vial of "Prolactin-releasing peptide receptor (PRLHR), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.