cAMP-dependent protein kinase catalytic subunit PRKX (Prkx) Recombinant Protein | Prkx recombinant protein
Recombinant Mouse cAMP-dependent protein kinase catalytic subunit PRKX (Prkx)
Gene Names
Prkx; PKX1; Pkare
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
cAMP-dependent protein kinase catalytic subunit PRKX (Prkx); Recombinant Mouse cAMP-dependent protein kinase catalytic subunit PRKX (Prkx); Prkx recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-355, full length protein
Sequence
MEPPAGAAATVKDPDHDPVKTKVSAPAADPKPRTSSQKAGHSLQDWDTIATVGTGTFGRVNLVKEKTGRQYCALKIMSIPDVIRLKQEQHVQNEKAVLKEINHPFLIKLLWTGHDNRFLYMLMEFVPGGELFTYLRNRGRFSSVASVFYATEIVCAIEYLHSKEIVYRDLKPENILLDREGHIKLTDFGFAKKLVDRTWTLCGTPEYLAPEVIQSKGHGRAVDWWALGILIFEMLSGFPPFFDDNPFGIYQKILACKIDFPRQLDFTSKDLIKKLLVVDRTRRLGNMKNGAEDIKRHRWFRGVEWESVPQRKLKPPIVPKLSGDGDISNFETYPESELDKTPSVSDKDLETFKNF
Sequence Length
355
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
40,467 Da
NCBI Official Full Name
cAMP-dependent protein kinase catalytic subunit PRKX
NCBI Official Synonym Full Names
protein kinase, X-linked
NCBI Official Symbol
Prkx
NCBI Official Synonym Symbols
PKX1; Pkare
NCBI Protein Information
cAMP-dependent protein kinase catalytic subunit PRKX
UniProt Protein Name
cAMP-dependent protein kinase catalytic subunit PRKX
Protein Family
UniProt Gene Name
Prkx
UniProt Synonym Gene Names
Pkare; PrKX; Protein kinase X; Protein kinase X-linked; Serine/threonine-protein kinase PRKX
Uniprot Description
Serine/threonine protein kinase regulated by and mediating cAMP signaling in cells. Acts through phosphorylation of downstream targets that may include CREB, SMAD6 and PKD1 and has multiple functions in cellular differentiation and epithelial morphogenesis. Regulates myeloid cell differentiation through SMAD6 phosphorylation. Involved in nephrogenesis by stimulating renal epithelial cell migration and tubulogenesis. Also involved in angiogenesis through stimulation of endothelial cell proliferation, migration and vascular-like structure formation.
Research Articles on Prkx
Similar Products
Product Notes
The Prkx prkx (Catalog #AAA1338289) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-355, full length protein. The amino acid sequence is listed below: MEPPAGAAAT VKDPDHDPVK TKVSAPAADP KPRTSSQKAG HSLQDWDTIA TVGTGTFGRV NLVKEKTGRQ YCALKIMSIP DVIRLKQEQH VQNEKAVLKE INHPFLIKLL WTGHDNRFLY MLMEFVPGGE LFTYLRNRGR FSSVASVFYA TEIVCAIEYL HSKEIVYRDL KPENILLDRE GHIKLTDFGF AKKLVDRTWT LCGTPEYLAP EVIQSKGHGR AVDWWALGIL IFEMLSGFPP FFDDNPFGIY QKILACKIDF PRQLDFTSKD LIKKLLVVDR TRRLGNMKNG AEDIKRHRWF RGVEWESVPQ RKLKPPIVPK LSGDGDISNF ETYPESELDK TPSVSDKDLE TFKNF. It is sometimes possible for the material contained within the vial of "cAMP-dependent protein kinase catalytic subunit PRKX (Prkx), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
