cAMP-dependent protein kinase catalytic subunit gamma (PRKACG) Recombinant Protein | PRKACG recombinant protein
Recombinant Human cAMP-dependent protein kinase catalytic subunit gamma (PRKACG)
Gene Names
PRKACG; KAPG; PKACg; BDPLT19
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
cAMP-dependent protein kinase catalytic subunit gamma (PRKACG); Recombinant Human cAMP-dependent protein kinase catalytic subunit gamma (PRKACG); PRKACG recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-351, Full length protein
Sequence
GNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVMLVRHQETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFSFKDNSYLYLVMEYVPGGEMFSRLQRVGRFSEPHACFYAAQVVLAVQYLHSLDLIHRDLKPENLLIDQQGYLQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAVGFPPFYADQPIQIYEKIVSGRVRFPSKLSSDLKHLLRSLLQVDLTKRFGNLRNGVGDIKNHKWFATTSWIAIYEKKVEAPFIPKYTGPGDASNFDDYEEEELRISINEKCAKEFSEF
Sequence Length
350
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for PRKACG recombinant protein
Cyclic AMP-dependent protein kinase (PKA) consists of two catalytic subunits and a regulatory subunit dimer. This gene encodes the gamma form of its catalytic subunit. The gene is intronless and is thought to be a retrotransposon derived from the gene for the alpha form of the PKA catalytic subunit.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
40,434 Da
NCBI Official Full Name
cAMP-dependent protein kinase catalytic subunit gamma
NCBI Official Synonym Full Names
protein kinase cAMP-activated catalytic subunit gamma
NCBI Official Symbol
PRKACG
NCBI Official Synonym Symbols
KAPG; PKACg; BDPLT19
NCBI Protein Information
cAMP-dependent protein kinase catalytic subunit gamma
UniProt Protein Name
cAMP-dependent protein kinase catalytic subunit gamma
Protein Family
UniProt Gene Name
PRKACG
UniProt Synonym Gene Names
PKA C-gamma
NCBI Description
Cyclic AMP-dependent protein kinase (PKA) consists of two catalytic subunits and a regulatory subunit dimer. This gene encodes the gamma form of its catalytic subunit. The gene is intronless and is thought to be a retrotransposon derived from the gene for the alpha form of the PKA catalytic subunit. [provided by RefSeq, Jul 2008]
Uniprot Description
Phosphorylates a large number of substrates in the cytoplasm and the nucleus.
Research Articles on PRKACG
Similar Products
Product Notes
The PRKACG prkacg (Catalog #AAA966011) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-351, Full length protein. The amino acid sequence is listed below: GNAPAKKDTE QEESVNEFLA KARGDFLYRW GNPAQNTASS DQFERLRTLG MGSFGRVMLV RHQETGGHYA MKILNKQKVV KMKQVEHILN EKRILQAIDF PFLVKLQFSF KDNSYLYLVM EYVPGGEMFS RLQRVGRFSE PHACFYAAQV VLAVQYLHSL DLIHRDLKPE NLLIDQQGYL QVTDFGFAKR VKGRTWTLCG TPEYLAPEII LSKGYNKAVD WWALGVLIYE MAVGFPPFYA DQPIQIYEKI VSGRVRFPSK LSSDLKHLLR SLLQVDLTKR FGNLRNGVGD IKNHKWFATT SWIAIYEKKV EAPFIPKYTG PGDASNFDDY EEEELRISIN EKCAKEFSEF. It is sometimes possible for the material contained within the vial of "cAMP-dependent protein kinase catalytic subunit gamma (PRKACG), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
