Peroxiredoxin-2 (PRDX2) Recombinant Protein | PRDX2 recombinant protein

Recombinant Human Peroxiredoxin-2 (PRDX2)

Cat. Num. AAA1233363

• Gene Names: PRDX2; PRP; TSA; PRX2; PTX1; TPX1; NKEFB; PRXII; TDPX1; NKEF-B; HEL-S-2a
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Peroxiredoxin-2 (PRDX2); Recombinant Human Peroxiredoxin-2 (PRDX2); Peroxiredoxin-2; EC=1.11.1.15; Natural killer cell-enhancing factor B; NKEF-B; PRP; Thiol-specific antioxidant protein; TSA; Thioredoxin peroxidase 1; Thioredoxin-dependent peroxide reductase 1; PRDX2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-198aa; Full Length of Mature Protein
• Sequence: ASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN

• Species: Homo sapiens (Human)
• Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-Page

Related Product Information for PRDX2 recombinant protein

Involved in redox regulation of the cell. Reduces peroxides with reducing equivalents provided through the thioredoxin system. It is not able to receive electrons from glutaredoxin. May play an important role in eliminating peroxides generated during metabolism. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H2O2.

Product Categories/Family for PRDX2 recombinant protein

Neuroscience

NCBI and Uniprot Product Information

• NCBI GI #: 32189392
• NCBI GeneID: 7001
• NCBI Accession #: NP_005800.3
• NCBI GenBank Nucleotide #: NM_005809.5
• UniProt Accession #: P32119; P31945; P32118; P35701; Q6FHG4; Q92763; Q9UC23; A8K0C0
• Molecular Weight: 23.8 kDa
• NCBI Official Full Name: peroxiredoxin-2
• NCBI Official Synonym Full Names: peroxiredoxin 2
• NCBI Official Symbol: PRDX2
• NCBI Official Synonym Symbols: PRP; TSA; PRX2; PTX1; TPX1; NKEFB; PRXII; TDPX1; NKEF-B; HEL-S-2a
• NCBI Protein Information: peroxiredoxin-2; torin; thioredoxin peroxidase 1; thiol-specific antioxidant 1; natural killer cell-enhancing factor B; thioredoxin-dependent peroxide reductase 1; epididymis secretory sperm binding protein Li 2a
• UniProt Protein Name: Peroxiredoxin-2
• Protein Family: Peroxiredoxin
• UniProt Gene Name: PRDX2
• UniProt Synonym Gene Names: NKEFB; TDPX1; NKEF-B; TSA
• UniProt Entry Name: PRDX2_HUMAN

NCBI Description

This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein plays an antioxidant protective role in cells, and it may contribute to the antiviral activity of CD8(+) T-cells. The crystal structure of this protein has been resolved to 2.7 angstroms. This protein prevents hemolytic anemia from oxidative stress by stabilizing hemoglobin, thus making this gene a therapeutic target for patients with hemolytic anemia. This protein may have a proliferative effect and play a role in cancer development or progression. Related pseudogenes have been identified on chromosomes 5, 6, 10 and 13. [provided by RefSeq, Mar 2013]

Uniprot Description

PRDX2: a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. Involved in redox regulation of the cell. Reduces peroxides with reducing equivalents provided through the thioredoxin system but not from glutaredoxin. May play an important role in eliminating peroxides generated during metabolism. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2). May have a proliferative effect and play a role in cancer development or progression. Three splice-variant isoforms have been identified.

Protein type: EC 1.11.1.15; Oxidoreductase

Chromosomal Location of Human Ortholog: 19p13.2

Cellular Component: cytoplasm; cytosol

Molecular Function: antioxidant activity; thioredoxin peroxidase activity

Biological Process: regulation of apoptosis; response to reactive oxygen species; removal of superoxide radicals; hydrogen peroxide catabolic process; negative regulation of neuron apoptosis; response to oxidative stress; negative regulation of apoptosis