Peptidyl-prolyl cis-trans isomerase A (PPIA) Recombinant Protein | PPIA recombinant protein
Recombinant Cat Peptidyl-prolyl cis-trans isomerase A (PPIA)
Gene Names
PPIA; ND1; cypA; MTND1; NADH1; MT-ND1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Peptidyl-prolyl cis-trans isomerase A (PPIA); Recombinant Cat Peptidyl-prolyl cis-trans isomerase A (PPIA); PPIA recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-164, full length protein
Sequence
MVNPIVFFDIAVDGEPLGRVSFDLFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFDDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGMVKEGMNIVEAMERFGSRNGKTSKKITIADCGQI
Sequence Length
164
Species
Felis catus (Cat) (Felis silvestris catus)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for PPIA recombinant protein
This gene encodes a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. The encoded protein is a cyclosporin binding-protein and may play a role in cyclosporin A-mediated immunosuppression. The protein can also interact with several HIV proteins, including p55 gag, Vpr, and capsid protein, and has been shown to be necessary for the formation of infectious HIV virions. Multiple pseudogenes that map to different chromosomes have been reported.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
17,870 Da
NCBI Official Full Name
peptidyl-prolyl cis-trans isomerase A
NCBI Official Symbol
PPIA
NCBI Official Synonym Symbols
ND1; cypA; MTND1; NADH1; MT-ND1
NCBI Protein Information
peptidyl-prolyl cis-trans isomerase A
UniProt Protein Name
Peptidyl-prolyl cis-trans isomerase A
Protein Family
UniProt Gene Name
PPIA
UniProt Synonym Gene Names
CYPA; PPIase A
Uniprot Description
PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Research Articles on PPIA
Similar Products
Product Notes
The PPIA ppia (Catalog #AAA1473678) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-164, full length protein. The amino acid sequence is listed below: MVNPIVFFDI AVDGEPLGRV SFDLFADKVP KTAENFRALS TGEKGFGYKG SCFHRIIPGF MCQGGDFTRH NGTGGKSIYG EKFDDENFIL KHTGPGILSM ANAGPNTNGS QFFICTAKTE WLDGKHVVFG MVKEGMNIVE AMERFGSRNG KTSKKITIAD CGQI. It is sometimes possible for the material contained within the vial of "Peptidyl-prolyl cis-trans isomerase A (PPIA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
