Peroxisome proliferator-activated receptor delta (PPARD) Recombinant Protein | PPARD recombinant protein
Recombinant Dog Peroxisome proliferator-activated receptor delta (PPARD)
Gene Names
PPARD; PPAR-beta; PPAR-delta
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Peroxisome proliferator-activated receptor delta (PPARD); Recombinant Dog Peroxisome proliferator-activated receptor delta (PPARD); PPARD recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-441, Full length protein
Sequence
MEQPPGEAAEVREEEEKKEVAEAEGAPELNGGPERSLPSSSYTDLSRSSSPPSLLDQLQMGGDGASCGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERICKIQKKNRNKCQYCRFQKCVALGMSHNAIRFGRMPEAEKRKLVAGLTANEGTQHNPQVADLKAFSKHIYNAYLKNFNMTKKKARGILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSNLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGTGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLINVPQVEAIQDTILRALEFHLQANHPYAQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDMY
Sequence Length
441
Species
Canis familiaris (Dog) (Canis lupus familiaris)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for PPARD recombinant protein
This gene encodes a member of the peroxisome proliferator-activated receptor (PPAR) family. PPARs are nuclear hormone receptors that bind peroxisome proliferators and control the size and number of peroxisomes produced by cells. PPARs mediate a variety of biological processes, and may be involved in the development of several chronic diseases, including diabetes, obesity, atherosclerosis, and cancer. This protein is a potent inhibitor of ligand-induced transcription activity of PPAR alpha and PPAR gamma. It may function as an integrator of transcription repression and nuclear receptor signaling. The expression of this gene is found to be elevated in colorectal cancer cells. The elevated expression can be repressed by adenomatosis polyposis coli (APC), a tumor suppressor protein related to APC
beta-catenin signaling pathway. Knockout studies in mice suggested the role of this protein in myelination of the corpus callosum, lipid metabolism, and epidermal cell proliferation.
beta-catenin signaling pathway. Knockout studies in mice suggested the role of this protein in myelination of the corpus callosum, lipid metabolism, and epidermal cell proliferation.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49,776 Da
NCBI Official Full Name
peroxisome proliferator-activated receptor delta
NCBI Official Synonym Full Names
peroxisome proliferator activated receptor delta
NCBI Official Symbol
PPARD
NCBI Official Synonym Symbols
PPAR-beta; PPAR-delta
NCBI Protein Information
peroxisome proliferator-activated receptor delta
UniProt Protein Name
Peroxisome proliferator-activated receptor delta
Protein Family
UniProt Gene Name
PPARD
UniProt Synonym Gene Names
NR1C2; PPARB; PPAR-delta; PPAR-beta
Uniprot Description
Ligand-activated transcription factor. Receptor that binds peroxisome proliferators such as hypolipidemic drugs and fatty acids. Has a preference for poly-unsaturated fatty acids, such as gamma-linoleic acid and eicosapentanoic acid. Once activated by a ligand, the receptor binds to promoter elements of target genes. Regulates the peroxisomal beta-oxidation pathway of fatty acids. Functions as transcription activator for the acyl-CoA oxidase gene. Decreases expression of NPC1L1 once activated by a ligand ().
Research Articles on PPARD
Similar Products
Product Notes
The PPARD ppard (Catalog #AAA1332086) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-441, Full length protein. The amino acid sequence is listed below: MEQPPGEAAE VREEEEKKEV AEAEGAPELN GGPERSLPSS SYTDLSRSSS PPSLLDQLQM GGDGASCGSL NMECRVCGDK ASGFHYGVHA CEGCKGFFRR TIRMKLEYEK CERICKIQKK NRNKCQYCRF QKCVALGMSH NAIRFGRMPE AEKRKLVAGL TANEGTQHNP QVADLKAFSK HIYNAYLKNF NMTKKKARGI LTGKASHTAP FVIHDIETLW QAEKGLVWKQ LVNGLPPYKE ISVHVFYRCQ CTTVETVREL TEFAKSIPSF SNLFLNDQVT LLKYGVHEAI FAMLASIVNK DGLLVANGTG FVTREFLRSL RKPFSDIIEP KFEFAVKFNA LELDDSDLAL FIAAIILCGD RPGLINVPQV EAIQDTILRA LEFHLQANHP YAQYLFPKLL QKMADLRQLV TEHAQMMQRI KKTETETSLH PLLQEIYKDM Y. It is sometimes possible for the material contained within the vial of "Peroxisome proliferator-activated receptor delta (PPARD), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
