Popeye domain-containing protein 2 (POPDC2) Recombinant Protein | POPDC2 recombinant protein
Recombinant Human Popeye domain-containing protein 2 (POPDC2)
Gene Names
POPDC2; POP2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Popeye domain-containing protein 2 (POPDC2); Recombinant Human Popeye domain-containing protein 2 (POPDC2); POPDC2 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-364aa; full length protein
Sequence
MSANSSRVGQLLLQGSACIRWKQDVEGAVYHLANCLLLLGFMGGSGVYGCFYLFGFLSAG YLCCVLWGWFSACGLDIVLWSFLLAVVCLLQLAHLVYRLREDTLPEEFDLLYKTLCLPLQ VPLQTYKEIVHCCEEQVLTLATEQTYAVEGETPINRLSLLLSGRVRVSQDGQFLHYIFPY QFMDSPEWESLQPSEEGVFQVTLTAETSCSYISWPRKSLHLLLTKERYISCLFSALLGYD ISEKLYTLNDKLFAKFGLRFDIRLPSLYHVLGPTAADAGPESEKGDEEVCEPAVSPPQAT PTSLQQTPPCSTPPATTNFPAPPTRARLSRPDSGILASRIPLQSYSQVISRGQAPLAPTH TPEL
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for POPDC2 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
40,115 Da
NCBI Official Full Name
popeye domain-containing protein 2 isoform 2
NCBI Official Synonym Full Names
popeye domain containing 2
NCBI Official Symbol
POPDC2
NCBI Official Synonym Symbols
POP2
NCBI Protein Information
popeye domain-containing protein 2
UniProt Protein Name
Popeye domain-containing protein 2
Protein Family
UniProt Gene Name
POPDC2
UniProt Synonym Gene Names
POP2; Popeye protein 2
UniProt Entry Name
POPD2_HUMAN
NCBI Description
This gene encodes a member of the POP family of proteins which contain three putative transmembrane domains. This membrane associated protein is predominantly expressed in skeletal and cardiac muscle, and may have an important function in these tissues. [provided by RefSeq, Jul 2008]
Uniprot Description
POPDC2: May play an important role in heart development. Belongs to the popeye family. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, multi-pass; Membrane protein, integral
Chromosomal Location of Human Ortholog: 3q13.33
Cellular Component: integral to membrane; sarcolemma
Similar Products
Product Notes
The POPDC2 popdc2 (Catalog #AAA7026842) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-364aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the POPDC2 popdc2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSANSSRVGQ LLLQGSACIR WKQDVEGAVY HLANCLLLLG FMGGSGVYGC FYLFGFLSAG YLCCVLWGWF SACGLDIVLW SFLLAVVCLL QLAHLVYRLR EDTLPEEFDL LYKTLCLPLQ VPLQTYKEIV HCCEEQVLTL ATEQTYAVEG ETPINRLSLL LSGRVRVSQD GQFLHYIFPY QFMDSPEWES LQPSEEGVFQ VTLTAETSCS YISWPRKSLH LLLTKERYIS CLFSALLGYD ISEKLYTLND KLFAKFGLRF DIRLPSLYHV LGPTAADAGP ESEKGDEEVC EPAVSPPQAT PTSLQQTPPC STPPATTNFP APPTRARLSR PDSGILASRI PLQSYSQVIS RGQAPLAPTH TPEL. It is sometimes possible for the material contained within the vial of "Popeye domain-containing protein 2 (POPDC2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
