SDS-PAGE
Ribonuclease P protein subunit p20 (POP7) Recombinant Protein | POP7 recombinant protein
Recombinant Human Ribonuclease P protein subunit p20 (POP7)
Gene Names
POP7; RPP2; RPP20; 0610037N12Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Ribonuclease P protein subunit p20 (POP7); Recombinant Human Ribonuclease P protein subunit p20 (POP7); Ribonuclease P protein subunit p20; RNaseP protein p20; EC=3.1.26.5; Ribonucleases P/MRP protein subunit POP7 homolog; hPOP7; POP7 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-140aa; Full Length
Sequence
MAENREPRGAVEAELDPVEYTLRKRLPSRLPRRPNDIYVNMKTDFKAQLARCQKLLDGGARGQNACSEIYIHGLGLAINRAINIALQLQAGSFGSLQVAANTSTVELVDELEPETDTREPLTRIRNNSAIHIRVFRVTPK
Sequence Length
140
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-PAGE
SDS-PAGE
Related Product Information for POP7 recombinant protein
Component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends. Also a component of RNase MRP complex, which cleaves pre-rRNA sequences.
Product Categories/Family for POP7 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
42.7 kDa
NCBI Official Full Name
ribonuclease P protein subunit p20
NCBI Official Synonym Full Names
processing of precursor 7, ribonuclease P/MRP subunit (S. cerevisiae)
NCBI Official Symbol
POP7
NCBI Official Synonym Symbols
RPP2; RPP20; 0610037N12Rik
NCBI Protein Information
ribonuclease P protein subunit p20; hPOP7; RNaseP protein p20; ribonucleases P/MRP protein subunit POP7 homolog; processing of precursor 7, ribonuclease P subunit; POP7 (processing of precursor, S. cerevisiae) homolog
UniProt Protein Name
Ribonuclease P protein subunit p20
Protein Family
UniProt Gene Name
POP7
UniProt Synonym Gene Names
RPP20; RNaseP protein p20; hPOP7
UniProt Entry Name
POP7_HUMAN
Uniprot Description
POP7: Component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends. Belongs to the histone-like Alba family.
Protein type: Nucleolus; Ribonuclease; EC 3.1.26.5
Chromosomal Location of Human Ortholog: 7q22
Cellular Component: nucleolar ribonuclease P complex; nucleus
Molecular Function: protein binding; ribonuclease P activity
Biological Process: tRNA processing
Research Articles on POP7
Similar Products
Product Notes
The POP7 pop7 (Catalog #AAA1141762) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-140aa; Full Length. The amino acid sequence is listed below: MAENREPRGA VEAELDPVEY TLRKRLPSRL PRRPNDIYVN MKTDFKAQLA RCQKLLDGGA RGQNACSEIY IHGLGLAINR AINIALQLQA GSFGSLQVAA NTSTVELVDE LEPETDTREP LTRIRNNSAI HIRVFRVTPK. It is sometimes possible for the material contained within the vial of "Ribonuclease P protein subunit p20 (POP7), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
