Western Blot (WB)
(Host: RabbitTarget Name: ZYG11ASample Type: Hela Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Rabbit ZYG11A Polyclonal Antibody | anti-ZYG11A antibody
ZYG11A Antibody - C-terminal region
Gene Names
ZYG11A; ZYG11
Reactivity
Cow, Dog, Horse, Human, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ZYG11A; Polyclonal Antibody; ZYG11A Antibody - C-terminal region; anti-ZYG11A antibody
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PEQTAQLEELFMAVKELLAIVKQKTTENLDDVTFLFTLKALWNLTDGSPA
Sequence Length
759
Applicable Applications for anti-ZYG11A antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 100%; Horse: 100%; Human: 100%; Rabbit: 77%; Rat: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human ZYG11A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: ZYG11ASample Type: Hela Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: ZYG11ASample Type: Hela Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-ZYG11A antibody
This is a rabbit polyclonal antibody against ZYG11A. It was validated on Western Blot
Target Description: ZYG11A probably acts as target recruitment subunit in an E3 ubiquitin ligase complex ZYGA-CUL2-elongin BC.
Target Description: ZYG11A probably acts as target recruitment subunit in an E3 ubiquitin ligase complex ZYGA-CUL2-elongin BC.
Product Categories/Family for anti-ZYG11A antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
85kDa
NCBI Official Full Name
protein zyg-11 homolog A isoform 1
NCBI Official Synonym Full Names
zyg-11 family member A, cell cycle regulator
NCBI Official Symbol
ZYG11A
NCBI Official Synonym Symbols
ZYG11
NCBI Protein Information
protein zyg-11 homolog A
UniProt Protein Name
Protein zyg-11 homolog A
Protein Family
UniProt Gene Name
ZYG11A
UniProt Synonym Gene Names
ZYG11
Uniprot Description
ZYG11A: Probably acts as target recruitment subunit in an E3 ubiquitin ligase complex ZYGA-CUL2-elongin BC. Belongs to the zyg-11 family. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Unknown function
Chromosomal Location of Human Ortholog: 1p32.3
Cellular Component: Cul2-RING ubiquitin ligase complex
Molecular Function: ubiquitin-protein transferase activity
Biological Process: protein ubiquitination; regulation of ubiquitin-protein transferase activity
Research Articles on ZYG11A
Similar Products
Product Notes
The ZYG11A zyg11a (Catalog #AAA3218321) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZYG11A Antibody - C-terminal region reacts with Cow, Dog, Horse, Human, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ZYG11A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ZYG11A zyg11a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PEQTAQLEEL FMAVKELLAI VKQKTTENLD DVTFLFTLKA LWNLTDGSPA. It is sometimes possible for the material contained within the vial of "ZYG11A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
