Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ZXDA Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Muscle)

Rabbit ZXDA Polyclonal Antibody | anti-ZXDA antibody

ZXDA antibody - middle region

Gene Names
ZXDA; ZNF896
Reactivity
Cow, Human, Pig, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ZXDA; Polyclonal Antibody; ZXDA antibody - middle region; anti-ZXDA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Human, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PAKAEWSVHPNSDFFGQEGETQFGFPNAAGNHGSQKERNLITVTGSSFLV
Sequence Length
799
Applicable Applications for anti-ZXDA antibody
Western Blot (WB)
Homology
Cow: 91%; Human: 100%; Pig: 91%; Rabbit: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ZXDA
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ZXDA Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Muscle)

Western Blot (WB) (WB Suggested Anti-ZXDA Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Muscle)
Related Product Information for anti-ZXDA antibody
This is a rabbit polyclonal antibody against ZXDA. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ZXDA contains 10 C2H2-type zinc fingers. It belongs to the ZXD family. ZXDA cooperates with CIITA to promote transcription of MHC class I and MHC class II genes.
Product Categories/Family for anti-ZXDA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
85kDa
NCBI Official Full Name
zinc finger X-linked protein ZXDA
NCBI Official Synonym Full Names
zinc finger X-linked duplicated A
NCBI Official Symbol
ZXDA
NCBI Official Synonym Symbols
ZNF896
NCBI Protein Information
zinc finger X-linked protein ZXDA
UniProt Protein Name
Zinc finger X-linked protein ZXDA
UniProt Gene Name
ZXDA
UniProt Entry Name
ZXDA_HUMAN

NCBI Description

This gene encodes one of two duplicated zinc finger genes on chromosome Xp11. This gene is the telomeric copy; GeneID 158586 ZXDB is the more centromeric copy. The two genes have 98% nucleotide sequence similarity, and the predicted proteins contain 10 tandem zinc finger motifs. [provided by RefSeq, Nov 2009]

Research Articles on ZXDA

Similar Products

Product Notes

The ZXDA zxda (Catalog #AAA3204340) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZXDA antibody - middle region reacts with Cow, Human, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's ZXDA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ZXDA zxda for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PAKAEWSVHP NSDFFGQEGE TQFGFPNAAG NHGSQKERNL ITVTGSSFLV. It is sometimes possible for the material contained within the vial of "ZXDA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.