Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ZSCAN2 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)

Rabbit ZSCAN2 Polyclonal Antibody | anti-ZSCAN2 antibody

ZSCAN2 antibody - N-terminal region

Gene Names
ZSCAN2; ZFP29; ZNF854
Reactivity
Cow, Dog, Human, Mouse, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ZSCAN2; Polyclonal Antibody; ZSCAN2 antibody - N-terminal region; anti-ZSCAN2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TTMILEDDSWVQEAVLQEDGPESEPFPQSAGKGGPQEEVTRGPQGALGRL
Sequence Length
613
Applicable Applications for anti-ZSCAN2 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 100%; Human: 100%; Mouse: 100%; Pig: 86%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ZSCAN2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ZSCAN2 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-ZSCAN2 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)
Related Product Information for anti-ZSCAN2 antibody
This is a rabbit polyclonal antibody against ZSCAN2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ZSCAN2 contains several copies of zinc finger motif, which is commonly found in transcriptional regulatory proteins. Studies in mice show that ZSCAN2 is expressed during embryonic development, and specifically in the testis in adult mice, suggesting that it may play a role in regulating genes in germ cells.The protein encoded by this gene contains several copies of zinc finger motif, which is commonly found in transcriptional regulatory proteins. Studies in mice show that this gene is expressed during embryonic development, and specifically in the testis in adult mice, suggesting that it may play a role in regulating genes in germ cells. Alternative splicing of this gene results in several transcript variants encoding different isoforms.The protein encoded by this gene contains several copies of zinc finger motif, which is commonly found in transcriptional regulatory proteins. Studies in mice show that this gene is expressed during embryonic development, and specifically in the testis in adult mice, suggesting that it may play a role in regulating genes in germ cells. Alternative splicing of this gene results in several transcript variants encoding different isoforms.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
67kDa
NCBI Official Full Name
zinc finger and SCAN domain-containing protein 2 isoform 1
NCBI Official Synonym Full Names
zinc finger and SCAN domain containing 2
NCBI Official Symbol
ZSCAN2
NCBI Official Synonym Symbols
ZFP29; ZNF854
NCBI Protein Information
zinc finger and SCAN domain-containing protein 2
UniProt Protein Name
Zinc finger and SCAN domain-containing protein 2
UniProt Gene Name
ZSCAN2
UniProt Synonym Gene Names
ZFP29; ZNF854; Zfp-29
UniProt Entry Name
ZSCA2_HUMAN

NCBI Description

The protein encoded by this gene contains several copies of zinc finger motif, which is commonly found in transcriptional regulatory proteins. Studies in mice show that this gene is expressed during embryonic development, and specifically in the testis in adult mice, suggesting that it may play a role in regulating genes in germ cells. Alternative splicing of this gene results in several transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: May be involved in transcriptional regulation during the post-meiotic stages of spermatogenesis

By similarity.

Subcellular location: Nucleus

By similarity.

Sequence similarities: Belongs to the krueppel C2H2-type zinc-finger protein family.Contains 14 C2H2-type zinc fingers.Contains 1 SCAN box domain.

Sequence caution: The sequence BAC87537.1 differs from that shown. Reason: Erroneous translation. Aberrant splicing.

Research Articles on ZSCAN2

Similar Products

Product Notes

The ZSCAN2 zscan2 (Catalog #AAA3204985) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZSCAN2 antibody - N-terminal region reacts with Cow, Dog, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ZSCAN2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ZSCAN2 zscan2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TTMILEDDSW VQEAVLQEDG PESEPFPQSA GKGGPQEEVT RGPQGALGRL. It is sometimes possible for the material contained within the vial of "ZSCAN2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.