Western Blot (WB)
(Western blot analysis of ZP1 expression in rat ovary extract (lane 1) and SKOV3 whole cell lysates (lane 2). ZP1 at 70KD; 100KD was detected using rabbit anti-ZP1 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )
Rabbit ZP1 Polyclonal Antibody | anti-ZP1 antibody
Anti-ZP1 Antibody
Gene Names
ZP1; OOMD; OOMD1; HEL163
Reactivity
Human, RatNo cross reactivity with other proteins.
Applications
Western Blot
Purity
Immunogen affinity purified.
Synonyms
ZP1; Polyclonal Antibody; Anti-ZP1 Antibody; Zp1; Zp-1; Zp 1; P60852; Zona pellucida sperm-binding protein 1; zona pellucida glycoprotein 1; anti-ZP1 antibody
Host
Rabbit
Reactivity
Human, Rat
No cross reactivity with other proteins.
No cross reactivity with other proteins.
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Sequence Length
638
Applicable Applications for anti-ZP1 antibody
Western Blot (WB)
Application Notes
Western Blot: 0.1-0.5mug/ml; Tested Species: Human, Rat
Tested Species:In-house tested species with positive results.
Other applications have not been tested.
Tested Species:In-house tested species with positive results.
Other applications have not been tested.
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human ZP1 (102-139aa HVLEKDGRFHLRVFMEAVLPNGRVDVAQDATLICPKPD), different from the related mouse sequence by four amino acids, and from the related rat sequence by five amino acids.
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Western Blot (WB)
(Western blot analysis of ZP1 expression in rat ovary extract (lane 1) and SKOV3 whole cell lysates (lane 2). ZP1 at 70KD; 100KD was detected using rabbit anti-ZP1 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )
Western Blot (WB)
(Western blot analysis of ZP1 expression in rat ovary extract (lane 1) and SKOV3 whole cell lysates (lane 2). ZP1 at 70KD; 100KD was detected using rabbit anti-ZP1 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )
Related Product Information for anti-ZP1 antibody
Rabbit IgG polyclonal antibody for Zona pellucida sperm-binding protein 1 (ZP1) detection.
Background: Zona pellucida sperm-binding protein 1 (ZP1) is a protein that belopngs to the mammalian zona pellucida. The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed primarily of three or four glycoproteins with various functions during fertilization and preimplantation development. Zp1 ensures the structural integrity of the zona pellucida. Mutations in this gene are a cause of oocyte maturation defect and infertility. And this gene is mapped to chromosome 11q12.2.
Background: Zona pellucida sperm-binding protein 1 (ZP1) is a protein that belopngs to the mammalian zona pellucida. The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed primarily of three or four glycoproteins with various functions during fertilization and preimplantation development. Zp1 ensures the structural integrity of the zona pellucida. Mutations in this gene are a cause of oocyte maturation defect and infertility. And this gene is mapped to chromosome 11q12.2.
References
1. Gross, M. B. Personal Communication. Baltimore, Md. 6/24/2014.
2. Huang, Hua-Lin; Lv, Chao; Zhao, Ying-Chun; Li, Wen; He, Xue-Mei; Li, Ping; Sha, Ai-Guo; Tian, Xiao; Papasian, Christopher J.; Deng, Hong-Wen; Lu, Guang-Xiu; Xiao, Hong-Mei (2014). "Mutant ZP1 in Familial Infertility". New England Journal of Medicine 370 (13): 1220-1226.
3. Rankin, T., Talbot, P., Lee, E., Dean, J. Abnormal zonae pellucidae in mice lacking ZP1 result in early embryonic loss.Development 126: 3847-3855, 1999.
2. Huang, Hua-Lin; Lv, Chao; Zhao, Ying-Chun; Li, Wen; He, Xue-Mei; Li, Ping; Sha, Ai-Guo; Tian, Xiao; Papasian, Christopher J.; Deng, Hong-Wen; Lu, Guang-Xiu; Xiao, Hong-Mei (2014). "Mutant ZP1 in Familial Infertility". New England Journal of Medicine 370 (13): 1220-1226.
3. Rankin, T., Talbot, P., Lee, E., Dean, J. Abnormal zonae pellucidae in mice lacking ZP1 result in early embryonic loss.Development 126: 3847-3855, 1999.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
70,049 Da
NCBI Official Full Name
zona pellucida sperm-binding protein 1
NCBI Official Synonym Full Names
zona pellucida glycoprotein 1
NCBI Official Symbol
ZP1
NCBI Official Synonym Symbols
OOMD; OOMD1; HEL163
NCBI Protein Information
zona pellucida sperm-binding protein 1
UniProt Protein Name
Zona pellucida sperm-binding protein 1
Protein Family
UniProt Gene Name
ZP1
UniProt Synonym Gene Names
Zp-1
UniProt Entry Name
ZP1_HUMAN
NCBI Description
The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed primarily of three or four glycoproteins with various functions during fertilization and preimplantation development. The protein encoded by this gene ensures the structural integrity of the zona pellucida. Mutations in this gene are a cause of oocyte maturation defect and infertility. [provided by RefSeq, May 2014]
Uniprot Description
ZP1: The mammalian zona pellucida, which mediates species- specific sperm binding, induction of the acrosome reaction and prevents post-fertilization polyspermy, is composed of three to four glycoproteins, ZP1, ZP2, ZP3, and ZP4. ZP1 ensures the structural integrity of the zona pellucida. Belongs to the ZP domain family. ZPB subfamily.
Protein type: Membrane protein, integral
Chromosomal Location of Human Ortholog: 11q12.2
Cellular Component: extracellular region
Biological Process: binding of sperm to zona pellucida
Disease: Oocyte Maturation Defect
Research Articles on ZP1
Similar Products
Product Notes
The ZP1 zp1 (Catalog #AAA178470) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-ZP1 Antibody reacts with Human, Rat No cross reactivity with other proteins. and may cross-react with other species as described in the data sheet. AAA Biotech's ZP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot: 0.1-0.5mug/ml; Tested Species: Human, Rat Tested Species:In-house tested species with positive results. Other applications have not been tested. Researchers should empirically determine the suitability of the ZP1 zp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ZP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
