Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ZNF498 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)

Rabbit ZNF498 Polyclonal Antibody | anti-ZSCAN25 antibody

ZNF498 antibody - N-terminal region

Gene Names
ZSCAN25; ZNF498
Reactivity
Horse, Human, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ZNF498; Polyclonal Antibody; ZNF498 antibody - N-terminal region; anti-ZSCAN25 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Horse, Human, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MLKEHPEMAEAPQQQLGIPVVKLEKELPWGRGREDPSPETFRLRFRQFRY
Sequence Length
544
Applicable Applications for anti-ZSCAN25 antibody
Western Blot (WB)
Homology
Horse: 79%; Human: 100%; Rabbit: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF498
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ZNF498 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-ZNF498 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)
Related Product Information for anti-ZSCAN25 antibody
This is a rabbit polyclonal antibody against ZNF498. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The function of ZNF498 remains unknown. The protein bears some similarity to zinc finger proteins, which are involved in DNA binding and protein-protein interactions. Alternative splicing results in two transcript variants encoding different proteins. Additional splice variants have been identified, but their biological validity has not been determined. This gene encodes a protein that bears some similarity to zinc finger proteins, which are involved in DNA binding and protein-protein interactions. Multiple alternatively spliced transcript variants have been identified, but the full-length nature for most of them has not been determined.
Product Categories/Family for anti-ZSCAN25 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61kDa
NCBI Official Full Name
zinc finger and SCAN domain-containing protein 25 isoform a
NCBI Official Synonym Full Names
zinc finger and SCAN domain containing 25
NCBI Official Symbol
ZSCAN25
NCBI Official Synonym Symbols
ZNF498
NCBI Protein Information
zinc finger and SCAN domain-containing protein 25
UniProt Protein Name
Zinc finger and SCAN domain-containing protein 25
UniProt Gene Name
ZSCAN25
UniProt Synonym Gene Names
ZNF498
UniProt Entry Name
ZSC25_HUMAN

NCBI Description

This gene encodes a protein that bears some similarity to zinc finger proteins, which are involved in DNA binding and protein-protein interactions. Multiple alternatively spliced transcript variants have been identified, but the full-length nature for most of them has not been determined. [provided by RefSeq, Jul 2008]

Uniprot Description

ZNF498: May be involved in transcriptional regulation. Belongs to the krueppel C2H2-type zinc-finger protein family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: C2H2-type zinc finger protein; DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 7q22.1

Cellular Component: nucleus

Molecular Function: DNA binding; metal ion binding; transcription factor activity

Biological Process: transcription, DNA-dependent; regulation of transcription, DNA-dependent

Similar Products

Product Notes

The ZSCAN25 zscan25 (Catalog #AAA3204874) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZNF498 antibody - N-terminal region reacts with Horse, Human, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF498 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ZSCAN25 zscan25 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MLKEHPEMAE APQQQLGIPV VKLEKELPWG RGREDPSPET FRLRFRQFRY. It is sometimes possible for the material contained within the vial of "ZNF498, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.