Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ZNF460 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: OVCAR-3 cell lysateZNF460 is supported by BioGPS gene expression data to be expressed in OVCAR3)

Rabbit anti-Human ZNF460 Polyclonal Antibody | anti-ZNF460 antibody

ZNF460 antibody - N-terminal region

Gene Names
ZNF460; HZF8; ZNF272
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ZNF460; Polyclonal Antibody; ZNF460 antibody - N-terminal region; anti-ZNF460 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ALYVEVMLETCGLLVALGDSTKPETVEPIPSHLALPEEVSLQEQLAQGVP
Sequence Length
562
Applicable Applications for anti-ZNF460 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF460
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ZNF460 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: OVCAR-3 cell lysateZNF460 is supported by BioGPS gene expression data to be expressed in OVCAR3)

Western Blot (WB) (WB Suggested Anti-ZNF460 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: OVCAR-3 cell lysateZNF460 is supported by BioGPS gene expression data to be expressed in OVCAR3)
Related Product Information for anti-ZNF460 antibody
This is a rabbit polyclonal antibody against ZNF460. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ZNF460 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 11 C2H2-type zinc fingers and 1 KRAB domain. ZNF460 may be involved in transcriptional regulation.Zinc finger proteins, such as ZNF272, interact with nucleic acids and have diverse functions. The zinc finger domain is a conserved amino acid sequence motif containing 2 specifically positioned cysteines and 2 histidines that are involved in coordinating zinc. Kruppel-related proteins form 1 family of zinc finger proteins. See ZFP93 (MIM 604749) for additional information on zinc finger proteins.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-322 DA991801.1 1-322 323-2011 BC118625.1 1-1689 2012-3494 AC005261.2 120007-121489 3495-3849 AK074582.1 1463-1817

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64kDa
NCBI Official Full Name
zinc finger protein 460 isoform 1
NCBI Official Synonym Full Names
zinc finger protein 460
NCBI Official Symbol
ZNF460
NCBI Official Synonym Symbols
HZF8; ZNF272
NCBI Protein Information
zinc finger protein 460
UniProt Protein Name
Zinc finger protein 460
Protein Family
UniProt Gene Name
ZNF460
UniProt Synonym Gene Names
ZNF272
UniProt Entry Name
ZN460_HUMAN

NCBI Description

Zinc finger proteins, such as ZNF272, interact with nucleic acids and have diverse functions. The zinc finger domain is a conserved amino acid sequence motif containing 2 specifically positioned cysteines and 2 histidines that are involved in coordinating zinc. Kruppel-related proteins form 1 family of zinc finger proteins. See ZFP93 (MIM 604749) for additional information on zinc finger proteins.[supplied by OMIM, May 2004]

Uniprot Description

ZNF272: May be involved in transcriptional regulation. Belongs to the krueppel C2H2-type zinc-finger protein family.

Protein type: C2H2-type zinc finger protein

Chromosomal Location of Human Ortholog: 19q13.4

Cellular Component: nucleus

Molecular Function: DNA binding; metal ion binding

Biological Process: transcription, DNA-dependent; regulation of transcription, DNA-dependent

Research Articles on ZNF460

Similar Products

Product Notes

The ZNF460 znf460 (Catalog #AAA3209986) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZNF460 antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF460 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ZNF460 znf460 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ALYVEVMLET CGLLVALGDS TKPETVEPIP SHLALPEEVS LQEQLAQGVP. It is sometimes possible for the material contained within the vial of "ZNF460, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.